Polyclonal Anti-SYNJ2BP Antibody

synaptojanin 2 binding protein
References (8)
Recommended Applications
Product Description
Polyclonal Antibody against Human SYNJ2BP
Alternative Gene Names
Arip2
Open Datasheet
Price
$505.00
Product Number
HPA000866
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[7 pictures]
Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Show all images
[2 pictures]
Western blot analysis in human cell line RT-4.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
synaptojanin 2 binding protein
Target Gene
SYNJ2BP
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEG
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000090935 (96%)

Rat ENSRNOG00000006399 (95%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA000866 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA000866 on the Human Protein Atlas
Protein Name
synaptojanin 2 binding protein
Gene Name
SYNJ2BP
Alternative Gene Names
Arip2
UniProt ID
P57105
Gene (Ensembl)
ENSG00000213463
Entrez Gene ID
Entrez gene: 55333
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000213463 on the Human Protein Atlas

Ilacqua N, Anastasia I, Aloshyn D, Ghandehari-Alavijeh R, Peluso EA, Brearley-Sholto MC, Pellegrini LV, Raimondi A, de Aguiar Vallim TQ, Pellegrini L

Expression of Synj2bp in mouse liver regulates the extent of wrappER-mitochondria contact to maintain hepatic lipid homeostasis

Biol Direct , 2022 Dec 1; 17:37. Epub 2022 Dec 1

PubMed ID: 36457006 DOI: 10.1186/s13062-022-00344-8

Rusilowicz-Jones EV, Barone FG, Lopes FM, Stephen E, Mortiboys H, Urbé S, Clague MJ

Benchmarking a highly selective USP30 inhibitor for enhancement of mitophagy and pexophagy

Life Sci Alliance , 2021 Nov 29; 5(2):e202101287. Epub 2021 Nov 29

PubMed ID: 34844982 DOI: 10.26508/lsa.202101287

Coukos R, Yao D, Sanchez MI, Strand ET, Olive ME, Udeshi ND, Weissman JS, Carr SA, Bassik MC, Ting AY

An engineered transcriptional reporter of protein localization identifies regulators of mitochondrial and ER membrane protein trafficking in high-throughput CRISPRi screens

eLife , 2021 Aug 20; 10:e69142. Epub 2021 Aug 20

PubMed ID: 34414886 DOI: 10.7554/eLife.69142

Rusilowicz-Jones EV, Jardine J, Kallinos A, Pinto-Fernandez A, Guenther F, Giurrandino M, Barone FG, McCarron K, Burke CJ, Murad A, Martinez A, Marcassa E, Gersch M, Buckmelter AJ, Kayser-Bricker KJ, Lamoliatte F, Gajbhiye A, Davis S, Scott HC, Murphy E, England K, Mortiboys H, Komander D, Trost M, Kessler BM, Ioannidis S, Ahlijanian MK, Urbé S, Clague MJ

USP30 sets a trigger threshold for PINK1–PARKIN amplification of mitochondrial ubiquitylation

Life Sci Alliance , 2020 Jul 7; 3(8):e202000768. Epub 2020 Jul 7

PubMed ID: 32636217 DOI: 10.26508/lsa.202000768

Hartmann C, Schwietzer YA, Kummer D, Kirschnick N, Hoppe E, Thüring EM, Glaesner-Ebnet M, Brinkmann F, Gerke V, Reuter S, Nakayama M, Ebnet K

The mitochondrial outer membrane protein SYNJ2BP interacts with the cell adhesion molecule TMIGD1 and can recruit it to mitochondria

BMC Mol Cell Biol , 2020 Apr 17; 21:30. Epub 2020 Apr 17

PubMed ID: 32303178 DOI: 10.1186/s12860-020-00274-1

Hung V, Lam SS, Udeshi ND, Svinkina T, Guzman G, Mootha VK, Carr SA, Ting AY

Proteomic mapping of cytosol-facing outer mitochondrial and ER membranes in living human cells by proximity biotinylation

eLife , 2017 Apr 25; 6:e24463. Epub 2017 Apr 25

PubMed ID: 28441135 DOI: 10.7554/eLife.24463

Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M

Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics

Mol Cell Proteomics , 2009 Jul; 8(7):1612-1622. Epub 2009 Apr 7

PubMed ID: 19351664 DOI: 10.1074/mcp.M800539-MCP200

Did we miss your publication?

Have you published using HPA000866? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen SYNJ2BP (APrEST70409)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch