Enhanced Validation

Anti-SV2A Antibody

synaptic vesicle glycoprotein 2A
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human SV2A
Alternative Gene Names
KIAA0736, SV2
Price
$445.00
Product Number
HPA007863
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
synaptic vesicle glycoprotein 2A
Target Gene
SV2A
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQW
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000038486 (96%)

Rat ENSRNOG00000021182 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
synaptic vesicle glycoprotein 2A
Gene Name
SV2A
Alternative Gene Names
KIAA0736, SV2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000159164 on the Human Protein Atlas

Rassu M, Biosa A, Galioto M, Fais M, Sini P, Greggio E, Piccoli G, Crosio C, Iaccarino C

Levetiracetam treatment ameliorates LRRK2 pathological mutant phenotype

J Cell Mol Med , 2019 Sep 27; 23(12):8505-8510. Epub 2019 Sep 27

PubMed ID: 31560168 DOI: 10.1111/jcmm.14674

Brekk OR, Moskites A, Isacson O, Hallett PJ

Lipid-dependent deposition of alpha-synuclein and Tau on neuronal Secretogranin II-positive vesicular membranes with age

Sci Rep , 2018 Oct 12; 8:15207. Epub 2018 Oct 12

PubMed ID: 30315256 DOI: 10.1038/s41598-018-33474-z

Nensa FM, Neumann MH, Schrötter A, Przyborski A, Mastalski T, Susdalzew S, Looβe C, Helling S, El Magraoui F, Erdmann R, Meyer HE, Uszkoreit J, Eisenacher M, Suh J, Guénette SY, Röhner N, Kögel D, Theiss C, Marcus K, Müller T

Amyloid Beta A4 Precursor Protein-binding Family B Member 1 (FE65) Interactomics Revealed Synaptic Vesicle Glycoprotein 2A (SV2A) and Sarcoplasmic/Endoplasmic Reticulum Calcium ATPase 2 (SERCA2) as New Binding Proteins in the Human Brain

Mol Cell Proteomics , 2014 Feb; 13(2):475-488. Epub 2013 Nov 27

PubMed ID: 24284412 DOI: 10.1074/mcp.M113.029280

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

Did we miss your publication?

Have you published using HPA007863? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch