Enhanced Validation

Anti-SUSD2 Antibody

sushi domain containing 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SUSD2
Alternative Gene Names
BK65A6.2, FLJ22778
Price
$437.00
Product Number
HPA004117
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
sushi domain containing 2
Target gene
SUSD2
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNF
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000033389 (71%)

Mouse ENSMUSG00000006342 (70%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
sushi domain containing 2
Gene Name
SUSD2
Alternative Gene Names
BK65A6.2, FLJ22778
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000099994 on the Human Protein Atlas

Sheets JN, Iwanicki M, Liu JF, Howitt BE, Hirsch MS, Gubbels JA, Drapkin R, Egland KA

SUSD2 expression in high-grade serous ovarian cancer correlates with increased patient survival and defective mesothelial clearance

Oncogenesis , 2016 Oct 24; 5(10):e264-. Epub 2016 Oct 24

PubMed ID: 27775699 DOI: 10.1038/oncsis.2016.64

Pan W, Cheng Y, Zhang H, Liu B, Mo X, Li T, Li L, Cheng X, Zhang L, Ji J, Wang P, Han W

CSBF/C10orf99, a novel potential cytokine, inhibits colon cancer cell growth through inducing G1 arrest

Sci Rep , 2014 Oct 29; 4:6812. Epub 2014 Oct 29

PubMed ID: 25351403 DOI: 10.1038/srep06812

Lindgren D, Boström AK, Nilsson K, Hansson J, Sjölund J, Möller C, Jirström K, Nilsson E, Landberg G, Axelson H, Johansson ME

Isolation and characterization of progenitor-like cells from human renal proximal tubules.

Am J Pathol , 2011 Feb; 178(2):828-37

PubMed ID: 21281815 DOI: 10.1016/j.ajpath.2010.10.026

Did we miss your publication?

Have you published using HPA004117? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens