Enhanced Validation

Anti-SULT1E1 Antibody

sulfotransferase family 1E, estrogen-preferring, member 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SULT1E1
Alternative Gene Names
EST, STE
Price
$445.00
Product Number
HPA028728
Unit Size
100 µl
Concentration
Lot dependent
Availability
6 in Stock
Ships
Ready to Ship
Target Protein
sulfotransferase family 1E, estrogen-preferring, member 1
Target Gene
SULT1E1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000029272 (78%)

Rat ENSRNOG00000001957 (74%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
sulfotransferase family 1E, estrogen-preferring, member 1
Gene Name
SULT1E1
Alternative Gene Names
EST, STE
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000109193 on the Human Protein Atlas

Sinreih M, Knific T, Anko M, Hevir N, Vouk K, Jerin A, Frković Grazio S, Rižner TL

The Significance of the Sulfatase Pathway for Local Estrogen Formation in Endometrial Cancer

Front Pharmacol , 2017 Jun 23; 8:368. Epub 2017 Jun 23

PubMed ID: 28690541 DOI: 10.3389/fphar.2017.00368

Fischer L, Deppert WR, Pfeifer D, Stanzel S, Weimer M, Hanjalic-Beck A, Stein A, Straßer M, Zahradnik HP, Schaefer WR

Potential hazards to embryo implantation: A human endometrial in vitro model to identify unwanted antigestagenic actions of chemicals.

Toxicol Appl Pharmacol , 2012 May 1; 260(3):232-40

PubMed ID: 22414680 DOI: 10.1016/j.taap.2012.02.016

Did we miss your publication?

Have you published using HPA028728? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch