Enhanced Validation

Anti-STX17 Antibody

syntaxin 17
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human STX17
Alternative Gene Names
FLJ20651
Price
$445.00
Product Number
HPA001204
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
syntaxin 17
Target Gene
STX17
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000061455 (90%)

Rat ENSRNOG00000005801 (86%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
syntaxin 17
Gene Name
STX17
Alternative Gene Names
FLJ20651
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000136874 on the Human Protein Atlas

Wang B, Xiao X, Huang F, Liu R

Syntaxin-17-Dependent Mitochondrial Dynamics Is Essential for Protection against Oxidative-Stress-Induced Apoptosis

Antioxidants (Basel) , 2019 Oct 30; 8(11):522. Epub 2019 Oct 30

PubMed ID: 31671682 DOI: 10.3390/antiox8110522

Vats S, Manjithaya R

A reversible autophagy inhibitor blocks autophagosome–lysosome fusion by preventing Stx17 loading onto autophagosomes

Mol Biol Cell , 2019 Aug 1; 30(17):2283-2295

PubMed ID: 31188703 DOI: 10.1091/mbc.E18-08-0482

Xian H, Yang Q, Xiao L, Shen HM, Liou YC

STX17 dynamically regulated by Fis1 induces mitophagy via hierarchical macroautophagic mechanism

Nat Commun , 2019 May 3; 10:2059. Epub 2019 May 3

PubMed ID: 31053718 DOI: 10.1038/s41467-019-10096-1

Turco E, Witt M, Abert C, Bock-Bierbaum T, Su MY, Trapannone R, Sztacho M, Danieli A, Shi X, Zaffagnini G, Gamper A, Schuschnig M, Fracchiolla D, Bernklau D, Romanov J, Hartl M, Hurley JH, Daumke O, Martens S

FIP200 Claw Domain Binding to p62 Promotes Autophagosome Formation at Ubiquitin Condensates

Mol Cell , 2019 Apr 18; 74(2):330-346.e11

PubMed ID: 30853400 DOI: 10.1016/j.molcel.2019.01.035

Saito T, Nah J, Oka SI, Mukai R, Monden Y, Maejima Y, Ikeda Y, Sciarretta S, Liu T, Li H, Baljinnyam E, Fraidenraich D, Fritzky L, Zhai P, Ichinose S, Isobe M, Hsu CP, Kundu M, Sadoshima J

An alternative mitophagy pathway mediated by Rab9 protects the heart against ischemia

J Clin Invest , 2019 Jan 22; 129(2):802-819. Epub 2019 Jan 22

PubMed ID: 30511961 DOI: 10.1172/JCI122035

Xia Y, Liu N, Xie X, Bi G, Ba H, Li L, Zhang J, Deng X, Yao Y, Tang Z, Yin B, Wang J, Jiang K, Li Z, Choi Y, Gong F, Cheng X, O’Shea JJ, Chae JJ, Laurence A, Yang XP

The macrophage-specific V-ATPase subunit ATP6V0D2 restricts inflammasome activation and bacterial infection by facilitating autophagosome-lysosome fusion

Autophagy , 2019 Jan 29; 15(6):960-975. Epub 2019 Jan 29

PubMed ID: 30681394 DOI: 10.1080/15548627.2019.1569916

Matsui T, Jiang P, Nakano S, Sakamaki Y, Yamamoto H, Mizushima N

Autophagosomal YKT6 is required for fusion with lysosomes independently of syntaxin 17

J Cell Biol , 2018 Aug 6; 217(8):2633-2645

PubMed ID: 29789439 DOI: 10.1083/jcb.201712058

Wang C, Wang H, Zhang D, Luo W, Liu R, Xu D, Diao L, Liao L, Liu Z

Phosphorylation of ULK1 affects autophagosome fusion and links chaperone-mediated autophagy to macroautophagy

Nat Commun , 2018 Aug 28; 9:3492. Epub 2018 Aug 28

PubMed ID: 30154410 DOI: 10.1038/s41467-018-05449-1

Hua R, Han S, Zhang N, Dai Q, Liu T, Li J

cPKCγ-Modulated Sequential Reactivation of mTOR Inhibited Autophagic Flux in Neurons Exposed to Oxygen Glucose Deprivation/Reperfusion

Int J Mol Sci , 2018 May 6; 19(5):1380. Epub 2018 May 6

PubMed ID: 29734780 DOI: 10.3390/ijms19051380

Kumar S, Jain A, Farzam F, Jia J, Gu Y, Choi SW, Mudd MH, Claude-Taupin A, Wester MJ, Lidke KA, Rusten TE, Deretic V

Mechanism of Stx17 recruitment to autophagosomes via IRGM and mammalian Atg8 proteins

J Cell Biol , 2018 Mar 5; 217(3):997-1013

PubMed ID: 29420192 DOI: 10.1083/jcb.201708039

Kimura H, Arasaki K, Ohsaki Y, Fujimoto T, Ohtomo T, Yamada J, Tagaya M

Syntaxin 17 promotes lipid droplet formation by regulating the distribution of acyl-CoA synthetase 3

J Lipid Res , 2018 Mar 16; 59(5):805-819. Epub 2018 Mar 16

PubMed ID: 29549094 DOI: 10.1194/jlr.M081679

Fu R, Deng Q, Zhang H, Hu X, Li Y, Liu Y, Hu J, Luo Q, Zhang Y, Jiang X, Li L, Yang C, Gao N

A novel autophagy inhibitor berbamine blocks SNARE-mediated autophagosome-lysosome fusion through upregulation of BNIP3

Cell Death Dis , 2018 Feb 14; 9(2):243. Epub 2018 Feb 14

PubMed ID: 29445175 DOI: 10.1038/s41419-018-0276-8

Jung J, Behrends C

Protocol for Establishing a Multiplex Image-based Autophagy RNAi Screen in Cell Cultures

Bio Protoc , 2017 Sep 5; 7(17):27982478. Epub 2017 Sep 5

PubMed ID: 28966949 DOI: 10.21769/BioProtoc.2540

Uematsu M, Nishimura T, Sakamaki Y, Yamamoto H, Mizushima N

Accumulation of undegraded autophagosomes by expression of dominant-negative STX17 (syntaxin 17) mutants

Autophagy , 2017 Jun 9; 13(8):1452-1464. Epub 2017 Jun 9

PubMed ID: 28598244 DOI: 10.1080/15548627.2017.1327940

Beckerman P, Bi-Karchin J, Park AS, Qiu C, Dummer PD, Soomro I, Boustany-Kari CM, Pullen SS, Miner JH, Hu CA, Rohacs T, Inoue K, Ishibe S, Saleem MA, Palmer MB, Cuervo AM, Kopp JB, Susztak K

Transgenic Expression of Human APOL1 Risk Variants in Podocytes Induces Kidney Disease in Mice

Nat Med , 2017 Feb 20; 23(4):429-438. Epub 2017 Feb 20

PubMed ID: 28218918 DOI: 10.1038/nm.4287

Jung J, Nayak A, Schaeffer V, Starzetz T, Kirsch AK, Müller S, Dikic I, Mittelbronn M, Behrends C

Multiplex image-based autophagy RNAi screening identifies SMCR8 as ULK1 kinase activity and gene expression regulator

eLife , 2017 Feb 14; 6:e23063. Epub 2017 Feb 14

PubMed ID: 28195531 DOI: 10.7554/eLife.23063

Kimura T, Jia J, Kumar S, Choi SW, Gu Y, Mudd M, Dupont N, Jiang S, Peters R, Farzam F, Jain A, Lidke KA, Adams CM, Johansen T, Deretic V

Dedicated SNAREs and specialized TRIM cargo receptors mediate secretory autophagy

EMBO J , 2016 Dec 8; 36(1):42-60. Epub 2016 Dec 8

PubMed ID: 27932448 DOI: 10.15252/embj.201695081

Hubert V, Peschel A, Langer B, Gröger M, Rees A, Kain R

LAMP-2 is required for incorporating syntaxin-17 into autophagosomes and for their fusion with lysosomes

Biol Open , 2016 Sep 14; 5(10):1516-1529. Epub 2016 Sep 14

PubMed ID: 27628032 DOI: 10.1242/bio.018648

McLelland GL, Lee SA, McBride HM, Fon EA

Syntaxin-17 delivers PINK1/parkin-dependent mitochondrial vesicles to the endolysosomal system

J Cell Biol , 2016 Aug 1; 214(3):275-291

PubMed ID: 27458136 DOI: 10.1083/jcb.201603105

Ren H, Elgner F, Jiang B, Himmelsbach K, Medvedev R, Ploen D, Hildt E

The Autophagosomal SNARE Protein Syntaxin 17 Is an Essential Factor for the Hepatitis C Virus Life Cycle

J Virol , 2016 Jun 10; 90(13):5989-6000. Epub 2016 Jun 10

PubMed ID: 27099307 DOI: 10.1128/JVI.00551-16

Zhen Y, Li W

Impairment of autophagosome-lysosome fusion in the buff mutant mice with the VPS33AD251E mutation

Autophagy , 2015 Aug 11; 11(9):1608-1622. Epub 2015 Aug 11

PubMed ID: 26259518 DOI: 10.1080/15548627.2015.1072669

Diao J, Liu R, Rong Y, Zhao M, Zhang J, Lai Y, Zhou Q, Wilz LM, Li J, Vivona S, Pfuetzner RA, Brunger AT, Zhong Q

ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes

Nature , 2015 Apr 23; 520(7548):563-566. Epub 2015 Feb 9

PubMed ID: 25686604 DOI: 10.1038/nature14147

Jiang P, Nishimura T, Sakamaki Y, Itakura E, Hatta T, Natsume T, Mizushima N

The HOPS complex mediates autophagosome–lysosome fusion through interaction with syntaxin 17

Mol Biol Cell , 2014 Apr; 25(8):1327-1337

PubMed ID: 24554770 DOI: 10.1091/mbc.E13-08-0447

Did we miss your publication?

Have you published using HPA001204? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch