Enhanced Validation

Anti-SRGN Antibody

serglycin
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human SRGN
Alternative Gene Names
PPG, PRG, PRG1
Price
$445.00
Product Number
HPA000759
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
serglycin
Target Gene
SRGN
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000000394 (55%)

Mouse ENSMUSG00000020077 (53%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
serglycin
Gene Name
SRGN
Alternative Gene Names
PPG, PRG, PRG1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000122862 on the Human Protein Atlas

Guo JY, Chiu CH, Wang MJ, Li FA, Chen JY

Proteoglycan serglycin promotes non-small cell lung cancer cell migration through the interaction of its glycosaminoglycans with CD44

J Biomed Sci , 2020 Jan 2; 27:2. Epub 2020 Jan 2

PubMed ID: 31898491 DOI: 10.1186/s12929-019-0600-3

Roy A, Attarha S, Weishaupt H, Edqvist PH, Swartling FJ, Bergqvist M, Siebzehnrubl FA, Smits A, Pontén F, Tchougounova E

Serglycin as a potential biomarker for glioma: association of serglycin expression, extent of mast cell recruitment and glioblastoma progression

Oncotarget , 2017 Mar 1; 8(15):24815-24827. Epub 2017 Mar 1

PubMed ID: 28445977 DOI: 10.18632/oncotarget.15820

Guo JY, Hsu HS, Tyan SW, Li FY, Shew JY, Lee WH, Chen JY

Serglycin in tumor microenvironment promotes non-small cell lung cancer aggressiveness in a CD44-dependent manner

Oncogene , 2016 Nov 7; 36(17):2457-2471. Epub 2016 Nov 7

PubMed ID: 27819672 DOI: 10.1038/onc.2016.404

Trine M. Reine, Tram T. Vuong, Arkady Rutkovskiy, Astri J. Meen, Jarle Vaage, Trond G. Jenssen, Svein O. Kolset

Serglycin in Quiescent and Proliferating Primary Endothelial Cells

PLOS ONE , December 22, 2015

PubMed ID: 26694746 DOI: 10.1371/journal.pone.0145584

Purushothaman A, Toole BP

Serglycin Proteoglycan Is Required for Multiple Myeloma Cell Adhesion, in Vivo Growth, and Vascularization

J Biol Chem , 2014 Feb 28; 289(9):5499-5509. Epub 2014 Jan 8

PubMed ID: 24403068 DOI: 10.1074/jbc.M113.532143

Chang MY, Chan CK, Braun KR, Green PS, O'Brien KD, Chait A, Day AJ, Wight TN

Monocyte-to-macrophage differentiation: synthesis and secretion of a complex extracellular matrix.

J Biol Chem , 2012 Apr 20; 287(17):14122-35. Epub 2012 Feb 20

PubMed ID: 22351750 DOI: 10.1074/jbc.M111.324988

Ek S, Andréasson U, Hober S, Kampf C, Pontén F, Uhlén M, Merz H, Borrebaeck CA

From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies.

Mol Cell Proteomics , 2006 Jun; 5(6):1072-81. Epub 2006 Mar 8

PubMed ID: 16524965 DOI: 10.1074/mcp.M600077-MCP200

Did we miss your publication?

Have you published using HPA000759? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch