Polyclonal Anti-SRD5A3 Antibody

steroid 5 alpha-reductase 3
References (3)
Recommended Applications
Product Description
Polyclonal Antibody against Human SRD5A3
Alternative Gene Names
FLJ13352, SRD5A2L, SRD5A2L1
Open Datasheet
Price
$505.00
Product Number
HPA027006
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human skin shows weak granular cytoplasmic positivity squamous epithelial cells.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & vesicles.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
steroid 5 alpha-reductase 3
Target Gene
SRD5A3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000029233 (87%)

Rat ENSRNOG00000002216 (87%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Protein Name
steroid 5 alpha-reductase 3
Gene Name
SRD5A3
Alternative Gene Names
FLJ13352, SRD5A2L, SRD5A2L1
UniProt ID
Q9H8P0
Gene (Ensembl)
ENSG00000128039
Entrez Gene ID
Entrez gene: 79644
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000128039 on the Human Protein Atlas

Mai Q, Sheng D, Chen C, Gou Q, Chen M, Huang X, Yin H, Chen X, Chen Z

Steroid 5 alpha-reductase 3 (SRD5A3) promotes tumor growth and predicts poor survival of human hepatocellular carcinoma (HCC)

Aging (Albany NY) , 2020 Nov 20; 12(24):25395-25411. Epub 2020 Nov 20

PubMed ID: 33229626 DOI: 10.18632/aging.104142

Hamid AR, Kusuma Putra HW, Sari NP, Diana P, Sesari SS, Novita E, Gultom FL, Saraswati M, Tanurahardja B, Asmarinah, Umbas R, Mochtar CA

Early upregulation of AR and steroidogenesis enzyme expression after 3 months of androgen-deprivation therapy

BMC Urol , 2020 Jun 19; 20:71. Epub 2020 Jun 19

PubMed ID: 32560654 DOI: 10.1186/s12894-020-00627-0

Did we miss your publication?

Have you published using HPA027006? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen SRD5A3 (APrEST73279)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch