Enhanced Validation

Polyclonal Anti-SPOCK2 Antibody

sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2
References (3)
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human SPOCK2
Alternative Gene Names
KIAA0275, testican-2
Open Datasheet
Price
$505.00
Product Number
HPA044605
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[3 pictures]
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Show all images
[1 pictures]
Western blot analysis in control (vector only transfected HEK293T lysate) and SPOCK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414995).

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2
Target Gene
SPOCK2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000058297 (86%)

Rat ENSRNOG00000061544 (85%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA044605 on the Human Protein Atlas
Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2
Gene Name
SPOCK2
Alternative Gene Names
KIAA0275, testican-2
UniProt ID
Q92563
Gene (Ensembl)
ENSG00000107742
Entrez Gene ID
Entrez gene: 9806
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000107742 on the Human Protein Atlas

Pedrosa RM, Wismans LV, Sinke R, van der Weiden M, van Eijck CH, Kros JM, Mustafa DA

Differential Expression of BOC, SPOCK2, and GJD3 Is Associated with Brain Metastasis of ER-Negative Breast Cancers

Cancers (Basel) , 2021 Jun 15; 13(12):2982. Epub 2021 Jun 15

PubMed ID: 34203581 DOI: 10.3390/cancers13122982

Ngo D, Wen D, Gao Y, Keyes MJ, Drury ER, Katz DH, Benson MD, Sinha S, Shen D, Farrell LA, Peterson BD, Friedman DJ, Elmariah S, Young BA, Smith JG, Yang Q, Vasan RS, Larson MG, Correa A, Humphreys BD, Wang TJ, Pollak MR, Wilson JG, Gerszten RE, Rhee EP

Circulating testican-2 is a podocyte-derived marker of kidney health

Proc Natl Acad Sci U S A , 2020 Sep 21; 117(40):25026-25035. Epub 2020 Sep 21

PubMed ID: 32958645 DOI: 10.1073/pnas.2009606117

Did we miss your publication?

Have you published using HPA044605? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen SPOCK2 (APrEST80211)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch