Enhanced Validation

Anti-SOX9 Antibody

SRY (sex determining region Y)-box 9
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human SOX9
Alternative Gene Names
CMD1, CMPD1, SRA1
Price
$437.00
Product Number
HPA001758
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
SRY (sex determining region Y)-box 9
Target gene
SOX9
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000000567 (97%)

Rat ENSRNOG00000002607 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Genetic validation in WB by siRNA knockdown.

Protein Name
SRY (sex determining region Y)-box 9
Gene Name
SOX9
Alternative Gene Names
CMD1, CMPD1, SRA1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000125398 on the Human Protein Atlas

Ruan S, Deng J, Yan L, Huang W

Evaluation of the effects of the combination of BMP-2-modified BMSCs and PRP on cartilage defects

Exp Ther Med , 2018 Sep 19; 16(6):4569-4577. Epub 2018 Sep 19

PubMed ID: 30542406 DOI: 10.3892/etm.2018.6776

Sumita Y, Yamazaki M, Maruyama S, Abé T, Cheng J, Takagi R, Tanuma JI

Cytoplasmic expression of SOX9 as a poor prognostic factor for oral squamous cell carcinoma

Oncol Rep , 2018 Aug 22; 40(5):2487-2496. Epub 2018 Aug 22

PubMed ID: 30132562 DOI: 10.3892/or.2018.6665

Bombardo M, Saponara E, Malagola E, Chen R, Seleznik GM, Haumaitre C, Quilichini E, Zabel A, Reding T, Graf R, Sonda S

Class I histone deacetylase inhibition improves pancreatitis outcome by limiting leukocyte recruitment and acinar‐to‐ductal metaplasia

Br J Pharmacol , 2017 Sep 20; 174(21):3865-3880. Epub 2017 Sep 20

PubMed ID: 28832971 DOI: 10.1111/bph.13984

Sun Q, Wu G, Chen H, Chen L, Chen H, Zhu G, Zhao H

Hyperbaric oxygen protects type II collagen in interleukin-1β-induced mandibular condylar chondrocyte via inhibiting the JNK/c-Jun signaling pathway

Oncotarget , 2017 Jul 17; 8(36):60312-60323. Epub 2017 Jul 17

PubMed ID: 28947973 DOI: 10.18632/oncotarget.19294

Landfors M, Johansen J, Aronsen JM, Vågbø CB, Doré LC, He C, Sjaastad I, Sætrom P, Fedorcsák P, Dahl JA, Aanes H, Fußer M, Klungland A

Genome-wide profiling of DNA 5-hydroxymethylcytosine during rat Sertoli cell maturation

Cell Discov , 2017 May 9; 3:17013-. Epub 2017 May 9

PubMed ID: 28529766 DOI: 10.1038/celldisc.2017.13

del Valle I, Buonocore F, Duncan AJ, Lin L, Barenco M, Parnaik R, Shah S, Hubank M, Gerrelli D, Achermann JC

A genomic atlas of human adrenal and gonad development

Wellcome Open Res , 2017 Apr 7; 2:25. Epub 2017 Oct 23

PubMed ID: 28459107 DOI: 10.12688/wellcomeopenres.11253.1

Minkina A, Lindeman RE, Gearhart MD, Chassot AA, Chaboissier MC, Ghyselinck NB, Bardwell VJ, Zarkower D

Retinoic acid signaling is dispensable for somatic development and function in the mammalian ovary

Dev Biol , 2017 Mar 6; 424(2):208-220. Epub 2017 Mar 6

PubMed ID: 28274610 DOI: 10.1016/j.ydbio.2017.02.015

Li L, Newton PT, Bouderlique T, Sejnohova M, Zikmund T, Kozhemyakina E, Xie M, Krivanek J, Kaiser J, Qian H, Dyachuk V, Lassar AB, Warman ML, Barenius B, Adameyko I, Chagin AS

Superficial cells are self-renewing chondrocyte progenitors, which form the articular cartilage in juvenile mice

FASEB J , 2016 Dec 13; 31(3):1067-1084. Epub 2016 Dec 13

PubMed ID: 27965322 DOI: 10.1096/fj.201600918R

Chen YH, Chen HL, Chien CS, Wu SH, Ho YT, Yu CH, Chang MH

Contribution of Mature Hepatocytes to Biliary Regeneration in Rats with Acute and Chronic Biliary Injury

PLoS One , 2015; 10(8):e0134327. Epub 2015 Aug 26

PubMed ID: 26308208 DOI: 10.1371/journal.pone.0134327

Fantinato E, Milani L, Sironi G

Sox9 Expression in Canine Epithelial Skin Tumors

Eur J Histochem , 2015 Jul 9; 59(3):2514. Epub 2015 Jul 9

PubMed ID: 26428883 DOI: 10.4081/ejh.2015.2514

Roy N, Malik S, Villanueva KE, Urano A, Lu X, Von Figura G, Seeley ES, Dawson DW, Collisson EA, Hebrok M

Brg1 promotes both tumor-suppressive and oncogenic activities at distinct stages of pancreatic cancer formation

Genes Dev , 2015 Mar 15; 29(6):658-671

PubMed ID: 25792600 DOI: 10.1101/gad.256628.114

Bruun J, Kolberg M, Nesland JM, Svindland A, Nesbakken A, Lothe RA

Prognostic Significance of β-Catenin, E-Cadherin, and SOX9 in Colorectal Cancer: Results from a Large Population-Representative Series

Front Oncol , 2014; 4:118. Epub 2014 May 21

PubMed ID: 24904831 DOI: 10.3389/fonc.2014.00118

Capaccione KM, Hong X, Morgan KM, Liu W, Bishop MJ, Liu L, Markert E, Deen M, Minerowicz C, Bertino JR, Allen T, Pine SR

Sox9 mediates Notch1-induced mesenchymal features in lung adenocarcinoma

Oncotarget , 2014 Jun 15; 5(11):3636-3650. Epub 2014 May 13

PubMed ID: 25004243 DOI: 10.18632/oncotarget.1970

Rizzardi AE, Rosener NK, Koopmeiners JS, Isaksson Vogel R, Metzger GJ, Forster CL, Marston LO, Tiffany JR, McCarthy JB, Turley EA, Warlick CA, Henriksen JC, Schmechel SC

Evaluation of protein biomarkers of prostate cancer aggressiveness

BMC Cancer , 2014 Apr 5; 14:244. Epub 2014 Apr 5

PubMed ID: 24708576 DOI: 10.1186/1471-2407-14-244

Poulsen RC, Knowles HJ, Carr AJ, Hulley PA

Cell differentiation versus cell death: extracellular glucose is a key determinant of cell fate following oxidative stress exposure

Cell Death Dis , 2014 Feb 20; 5(2):e1074-. Epub 2014 Feb 20

PubMed ID: 24556689 DOI: 10.1038/cddis.2014.52

Vestentoft PS, Jelnes P, Hopkinson BM, Vainer B, Møllgård K, Quistorff B, Bisgaard HC

Three-dimensional reconstructions of intrahepatic bile duct tubulogenesis in human liver

BMC Dev Biol , 2011 Sep 26; 11:56. Epub 2011 Sep 26

PubMed ID: 21943389 DOI: 10.1186/1471-213X-11-56

Did we miss your publication?

Have you published using HPA001758? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch