Enhanced Validation

Polyclonal Anti-SOX6 Antibody

SRY (sex determining region Y)-box 6
References (7)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SOX6
Open Datasheet
Price
$505.00
Product Number
HPA001923
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human testis and tonsil tissues using HPA001923 antibody. Corresponding SOX6 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
SRY (sex determining region Y)-box 6
Target Gene
SOX6
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TYKPGDNYPVQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAAQPLNLSSRPKTAEPVKSPTS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000051910 (96%)

Rat ENSRNOG00000020514 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA001923 on the Human Protein Atlas
Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA001923 on the Human Protein Atlas
Protein Name
SRY (sex determining region Y)-box 6
Gene Name
SOX6
UniProt ID
P35712
Gene (Ensembl)
ENSG00000110693
Entrez Gene ID
Entrez gene: 55553
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000110693 on the Human Protein Atlas

Luppi MP, Azcorra M, Caronia-Brown G, Poulin JF, Gaertner Z, Gatica S, Moreno-Ramos OA, Nouri N, Dubois M, Ma YC, Ramakrishnan C, Fenno L, Kim YS, Deisseroth K, Cicchetti F, Dombeck DA, Awatramani R

Sox6 expression distinguishes dorsally and ventrally biased dopamine neurons in the substantia nigra with distinctive properties and embryonic origins

Cell Rep , 2021 Nov 9; 37(6):109975

PubMed ID: 34758317 DOI: 10.1016/j.celrep.2021.109975

Panda S, Dohare P, Jain S, Parikh N, Singla P, Mehdizadeh R, Klebe DW, Kleinman GM, Cheng B, Ballabh P

Estrogen Treatment Reverses Prematurity-Induced Disruption in Cortical Interneuron Population

J Neurosci , 2018 Aug 22; 38(34):7378-7391

PubMed ID: 30037831 DOI: 10.1523/JNEUROSCI.0478-18.2018

Tibrewal M, Cheng B, Dohare P, Hu F, Mehdizadeh R, Wang P, Zheng D, Ungvari Z, Ballabh P

Disruption of Interneuron Neurogenesis in Premature Newborns and Reversal with Estrogen Treatment

J Neurosci , 2018 Jan 31; 38(5):1100-1113

PubMed ID: 29246927 DOI: 10.1523/JNEUROSCI.1875-17.2017

Fernandes AM, Herlofsen SR, Karlsen TA, Küchler AM, Fløisand Y, Brinchmann JE

Similar Properties of Chondrocytes from Osteoarthritis Joints and Mesenchymal Stem Cells from Healthy Donors for Tissue Engineering of Articular Cartilage

PLoS One , 2013; 8(5):e62994. Epub 2013 May 9

PubMed ID: 23671648 DOI: 10.1371/journal.pone.0062994

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

Herlofsen SR, Küchler AM, Melvik JE, Brinchmann JE

Chondrogenic Differentiation of Human Bone Marrow-Derived Mesenchymal Stem Cells in Self-Gelling Alginate Discs Reveals Novel Chondrogenic Signature Gene Clusters

Tissue Eng Part A , 2011 Apr; 17(7-8):1003-1013. Epub 2010 Dec 27

PubMed ID: 21087199 DOI: 10.1089/ten.tea.2010.0499

Did we miss your publication?

Have you published using HPA001923? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-SOX6 (AMAb91382)
Anti-SOX6 (AMAb91383)
Anti-SOX6 (HPA003908)
Corresponding Antigens
PrEST Antigen SOX6 (APrEST86388)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch