Anti-SOX6 Antibody

SRY (sex determining region Y)-box 6
Recommended Applications
Product Description
Polyclonal Antibody against Human SOX6
Price
$437.00
Product Number
HPA001923
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
SRY (sex determining region Y)-box 6
Target gene
SOX6
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TYKPGDNYPVQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAAQPLNLSSRPKTAEPVKSPTS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000020514 (96%)

Mouse ENSMUSG00000051910 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Protein Name
SRY (sex determining region Y)-box 6
Gene Name
SOX6
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000110693 on the Human Protein Atlas

Panda S, Dohare P, Jain S, Parikh N, Singla P, Mehdizadeh R, Klebe DW, Kleinman GM, Cheng B, Ballabh P

Estrogen Treatment Reverses Prematurity-Induced Disruption in Cortical Interneuron Population

J Neurosci , 2018 Aug 22; 38(34):7378-7391

PubMed ID: 30037831 DOI: 10.1523/JNEUROSCI.0478-18.2018

Tibrewal M, Cheng B, Dohare P, Hu F, Mehdizadeh R, Wang P, Zheng D, Ungvari Z, Ballabh P

Disruption of Interneuron Neurogenesis in Premature Newborns and Reversal with Estrogen Treatment

J Neurosci , 2018 Jan 31; 38(5):1100-1113

PubMed ID: 29246927 DOI: 10.1523/JNEUROSCI.1875-17.2017

Fernandes AM, Herlofsen SR, Karlsen TA, Küchler AM, Fløisand Y, Brinchmann JE

Similar Properties of Chondrocytes from Osteoarthritis Joints and Mesenchymal Stem Cells from Healthy Donors for Tissue Engineering of Articular Cartilage

PLoS One , 2013; 8(5):e62994. Epub 2013 May 9

PubMed ID: 23671648 DOI: 10.1371/journal.pone.0062994

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

Herlofsen SR, Küchler AM, Melvik JE, Brinchmann JE

Chondrogenic Differentiation of Human Bone Marrow-Derived Mesenchymal Stem Cells in Self-Gelling Alginate Discs Reveals Novel Chondrogenic Signature Gene Clusters

Tissue Eng Part A , 2011 Apr; 17(7-8):1003-1013. Epub 2010 Dec 27

PubMed ID: 21087199 DOI: 10.1089/ten.tea.2010.0499

Did we miss your publication?

Have you published using HPA001923? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch