Anti-SOX11 Antibody

SRY (sex determining region Y)-box 11
Recommended Applications
Product Description
Polyclonal Antibody against Human SOX11
Price
$450.00
Product Number
HPA000536
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
SRY (sex determining region Y)-box 11
Target Gene
SOX11
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000030034 (82%)

Mouse ENSMUSG00000063632 (82%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
SRY (sex determining region Y)-box 11
Gene Name
SOX11
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000176887 on the Human Protein Atlas

Grönroos T, Mäkinen A, Laukkanen S, Mehtonen J, Nikkilä A, Oksa L, Rounioja S, Marincevic-Zuniga Y, Nordlund J, Pohjolainen V, Paavonen T, Heinäniemi M, Lohi O

Clinicopathological features and prognostic value of SOX11 in childhood acute lymphoblastic leukemia

Sci Rep , 2020 Feb 6; 10:2043. Epub 2020 Feb 6

PubMed ID: 32029838 DOI: 10.1038/s41598-020-58970-z

Lee W, Shin E, Kim BH, Kim H

Diagnostic accuracy of SOX11 immunohistochemistry in mantle cell lymphoma: A meta-analysis

PLoS One , 2019 Nov 12; 14(11):e0225096. Epub 2019 Nov 12

PubMed ID: 31714947 DOI: 10.1371/journal.pone.0225096

Miao Q, Hill MC, Chen F, Mo Q, Ku AT, Ramos C, Sock E, Lefebvre V, Nguyen H

SOX11 and SOX4 drive the reactivation of an embryonic gene program during murine wound repair

Nat Commun , 2019 Sep 6; 10:4042. Epub 2019 Sep 6

PubMed ID: 31492871 DOI: 10.1038/s41467-019-11880-9

Yang Z, Jiang S, Lu C, Ji T, Yang W, Li T, Lv J, Hu W, Yang Y, Jin Z

SOX11: friend or foe in tumor prevention and carcinogenesis?

Ther Adv Med Oncol , 2019 Jun 3; 11:1758835919853449. Epub 2019 Jun 3

PubMed ID: 31210798 DOI: 10.1177/1758835919853449

Lord M, Arvidsson G, Wasik AM, Christensson B, Wright AP, Grandien A, Sander B

Impact of Sox11 over-expression in Ba/F3 cells

Haematologica , 2018 Dec; 103(12):e594-e597

PubMed ID: 29954934 DOI: 10.3324/haematol.2018.197467

Otsuka Y, Nishikori M, Kitano T, Oka T, Ishikawa T, Haga H, Takaori‐Kondo A

Persistence of a t(11;14)‐positive clone in a patient with mantle cell lymphoma for 20 years

Clin Case Rep , 2017 Mar 2; 5(4):477-481. Epub 2017 Mar 2

PubMed ID: 28396772 DOI: 10.1002/ccr3.872

Inmaculada Ribera-Cortada, Daniel Martinez, Virginia Amador, Cristina Royo, Alba Navarro, Silvia Beà, Eva Gine, Laurence de Leval, Sergio Serrano, Andrew Wotherspoon, Dolors Colomer, Antonio Martinez, Elías Campo

Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtype

Modern Pathology , September 11, 2015

PubMed ID: 0 DOI: 10.1038/modpathol.2015.99

Wiemhoefer A, Stargardt A, van der Linden WA, Renner MC, van Kesteren RE, Stap J, Raspe MA, Tomkinson B, Kessels HW, Ovaa H, Overkleeft HS, Florea B, Reits EA

Tripeptidyl Peptidase II Mediates Levels of Nuclear Phosphorylated ERK1 and ERK2

Mol Cell Proteomics , 2015 Jun 3; 14(8):2177-2193. Epub 2015 Jun 3

PubMed ID: 26041847 DOI: 10.1074/mcp.M114.043331

Kuo PY, Leshchenko VV, Fazzari MJ, Perumal D, Gellen T, He T, Iqbal J, Baumgartner-Wennerholm S, Nygren L, Zhang F, Zhang W, Suh KS, Goy A, Yang DT, Chan WC, Kahl BS, Verma AK, Gascoyne RD, Kimby E, Sander B, Ye BH, Melnick AM, Parekh S

High resolution Chromatin Immunoprecipitation (ChIP) sequencing reveals novel bindings targets and prognostic role for SOX11 in Mantle cell lymphoma

Oncogene , 2015 Mar 5; 34(10):1231-1240. Epub 2014 Mar 31

PubMed ID: 24681958 DOI: 10.1038/onc.2014.44

Davidson B, Holth A, Hellesylt E, Tan TZ, Huang RY, Tropé C, Nesland JM, Thiery JP

The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions.

Hum Pathol , 2015 Jan; 46(1):1-8

PubMed ID: 25455994 DOI: 10.1016/j.humpath.2014.10.004

Cao X, Fan L, Fang C, Zhu DX, Dong HJ, Wang DM, Wang YH, Xu W, Li JY

The expression of SOX11, cyclin D1, cyclin D2, and cyclin D3 in B-cell lymphocytic proliferative diseases.

Med Oncol , 2012 Jun; 29(2):1190-6. Epub 2011 Apr 9

PubMed ID: 21479697 DOI: 10.1007/s12032-011-9937-5

Nygren L, Baumgartner Wennerholm S, Klimkowska M, Christensson B, Kimby E, Sander B

Prognostic role of SOX11 in a population-based cohort of mantle cell lymphoma.

Blood , 2012 May 3; 119(18):4215-23. Epub 2012 Mar 19

PubMed ID: 22431568 DOI: 10.1182/blood-2011-12-400580

Carvajal-Cuenca A, Sua LF, Silva NM, Pittaluga S, Royo C, Song JY, Sargent RL, Espinet B, Climent F, Jacobs SA, Delabie J, Naresh KN, Bagg A, Brousset P, Warnke RA, Serrano S, Harris NL, Swerdlow SH, Jaffe ES, Campo E

In situ mantle cell lymphoma: clinical implications of an incidental finding with indolent clinical behavior.

Haematologica , 2012 Feb; 97(2):270-8. Epub 2011 Nov 4

PubMed ID: 22058203 DOI: 10.3324/haematol.2011.052621

Sernbo S, Gustavsson E, Brennan DJ, Gallagher WM, Rexhepaj E, Rydnert F, Jirström K, Borrebaeck CA, Ek S

The tumour suppressor SOX11 is associated with improved survival among high grade epithelial ovarian cancers and is regulated by reversible promoter methylation.

BMC Cancer , 2011 Sep 24; 11:405. Epub 2011 Sep 24

PubMed ID: 21943380 DOI: 10.1186/1471-2407-11-405

Kimura Y, Sato K, Imamura Y, Arakawa F, Kiyasu J, Takeuchi M, Miyoshi H, Yoshida M, Niino D, Sugita Y, Morito T, Yoshino T, Nakamura S, Ohshima K

Small cell variant of mantle cell lymphoma is an indolent lymphoma characterized by bone marrow involvement, splenomegaly, and a low Ki-67 index.

Cancer Sci , 2011 Sep; 102(9):1734-41. Epub 2011 Jun 23

PubMed ID: 21609366 DOI: 10.1111/j.1349-7006.2011.01988.x

Ondrejka SL, Lai R, Smith SD, Hsi ED

Indolent mantle cell leukemia: a clinicopathological variant characterized by isolated lymphocytosis, interstitial bone marrow involvement, kappa light chain restriction, and good prognosis.

Haematologica , 2011 Aug; 96(8):1121-7. Epub 2011 Apr 20

PubMed ID: 21508124 DOI: 10.3324/haematol.2010.036277

Wang X, Björklund S, Wasik AM, Grandien A, Andersson P, Kimby E, Dahlman-Wright K, Zhao C, Christensson B, Sander B

Gene Expression Profiling and Chromatin Immunoprecipitation Identify DBN1, SETMAR and HIG2 as Direct Targets of SOX11 in Mantle Cell Lymphoma

PLoS One , 2010 Nov 22; 5(11):e14085. Epub 2010 Nov 22

PubMed ID: 21124928 DOI: 10.1371/journal.pone.0014085

Gustavsson E, Sernbo S, Andersson E, Brennan DJ, Dictor M, Jerkeman M, Borrebaeck CA, Ek S

SOX11 expression correlates to promoter methylation and regulates tumor growth in hematopoietic malignancies.

Mol Cancer , 2010 Jul 12; 9:187. Epub 2010 Jul 12

PubMed ID: 20624318 DOI: 10.1186/1476-4598-9-187

Aiden AP, Rivera MN, Rheinbay E, Ku M, Coffman EJ, Truong TT, Vargas SO, Lander ES, Haber DA, Bernstein BE

Wilms Tumor Chromatin Profiles Highlight Stem Cell Properties and a Renal Developmental Network

Cell Stem Cell , 2010 Jun 4; 6(6):591-602

PubMed ID: 20569696 DOI: 10.1016/j.stem.2010.03.016

Fernàndez V, Salamero O, Espinet B, Solé F, Royo C, Navarro A, Camacho F, Beà S, Hartmann E, Amador V, Hernández L, Agostinelli C, Sargent RL, Rozman M, Aymerich M, Colomer D, Villamor N, Swerdlow SH, Pileri SA, Bosch F, Piris MA, Montserrat E, Ott G, Rosenwald A, López-Guillermo A, Jares P, Serrano S, Campo E

Genomic and gene expression profiling defines indolent forms of mantle cell lymphoma.

Cancer Res , 2010 Feb 15; 70(4):1408-18. Epub 2010 Feb 2

PubMed ID: 20124476 DOI: 10.1158/0008-5472.CAN-09-3419

Chen YH, Gao J, Fan G, Peterson LC

Nuclear expression of sox11 is highly associated with mantle cell lymphoma but is independent of t(11;14)(q13;q32) in non-mantle cell B-cell neoplasms.

Mod Pathol , 2010 Jan; 23(1):105-12. Epub 2009 Oct 2

PubMed ID: 19801969 DOI: 10.1038/modpathol.2009.140

Mozos A, Royo C, Hartmann E, De Jong D, Baró C, Valera A, Fu K, Weisenburger DD, Delabie J, Chuang SS, Jaffe ES, Ruiz-Marcellan C, Dave S, Rimsza L, Braziel R, Gascoyne RD, Solé F, López-Guillermo A, Colomer D, Staudt LM, Rosenwald A, Ott G, Jares P, Campo E

SOX11 expression is highly specific for mantle cell lymphoma and identifies the cyclin D1-negative subtype.

Haematologica , 2009 Nov; 94(11):1555-62

PubMed ID: 19880778 DOI: 10.3324/haematol.2009.010264

Dictor M, Ek S, Sundberg M, Warenholt J, György C, Sernbo S, Gustavsson E, Abu-Alsoud W, Wadström T, Borrebaeck C

Strong lymphoid nuclear expression of SOX11 transcription factor defines lymphoblastic neoplasms, mantle cell lymphoma and Burkitt's lymphoma.

Haematologica , 2009 Nov; 94(11):1563-8

PubMed ID: 19880779 DOI: 10.3324/haematol.2009.008474

Wang X, Asplund AC, Porwit A, Flygare J, Smith CI, Christensson B, Sander B

The subcellular Sox11 distribution pattern identifies subsets of mantle cell lymphoma: correlation to overall survival.

Br J Haematol , 2008 Oct; 143(2):248-52. Epub 2008 Aug 20

PubMed ID: 18729857 DOI: 10.1111/j.1365-2141.2008.07329.x

Ek S, Dictor M, Jerkeman M, Jirström K, Borrebaeck CA

Nuclear expression of the non B-cell lineage Sox11 transcription factor identifies mantle cell lymphoma.

Blood , 2008 Jan 15; 111(2):800-5. Epub 2007 Oct 12

PubMed ID: 17934069 DOI: 10.1182/blood-2007-06-093401

Ek S, Andréasson U, Hober S, Kampf C, Pontén F, Uhlén M, Merz H, Borrebaeck CA

From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies.

Mol Cell Proteomics , 2006 Jun; 5(6):1072-81. Epub 2006 Mar 8

PubMed ID: 16524965 DOI: 10.1074/mcp.M600077-MCP200

Did we miss your publication?

Have you published using HPA000536? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch