Enhanced Validation

Anti-SNRPD3 Antibody

small nuclear ribonucleoprotein D3 polypeptide 18kDa
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human SNRPD3
Alternative Gene Names
Sm-D3, SMD3
Price
$437.00
Product Number
HPA001170
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
small nuclear ribonucleoprotein D3 polypeptide 18kDa
Target gene
SNRPD3
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNI
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000050410 (100%)

Mouse ENSMUSG00000020180 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
small nuclear ribonucleoprotein D3 polypeptide 18kDa
Gene Name
SNRPD3
Alternative Gene Names
Sm-D3, SMD3
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000100028 on the Human Protein Atlas

Braun CJ, Stanciu M, Boutz PL, Patterson JC, Calligaris D, Higuchi F, Neupane R, Fenoglio S, Cahill DP, Wakimoto H, Agar NY, Yaffe MB, Sharp PA, Hemann MT, Lees JA

Coordinated Splicing of Regulatory Detained Introns within Oncogenic Transcripts Creates an Exploitable Vulnerability in Malignant Glioma

Cancer Cell , 2017 Sep 28; 32(4):411-426.e11. Epub 2017 Sep 28

PubMed ID: 28966034 DOI: 10.1016/j.ccell.2017.08.018

Elayne Chan-Penebre, Kristy G Kuplast, Christina R Majer, P Ann Boriack-Sjodin, Tim J Wigle, L Danielle Johnston, Nathalie Rioux, Michael J Munchhof, Lei Jin, Suzanne L Jacques, Kip A West, Trupti Lingaraj, Kimberly Stickland, Scott A Ribich, Alejandra Raimondi, Margaret Porter Scott, Nigel J Waters, Roy M Pollock, Jesse J Smith, Olena Barbash, Melissa Pappalardi, Thau F Ho, Kelvin Nurse, Khyati P Oza, Kathleen T Gallagher, Ryan Kruger, Mikel P Moyer, Robert A Copeland, Richard Chesworth, Kenneth W Duncan

A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models

Nature Chemical Biology , April 27, 2015

PubMed ID: 0 DOI: 10.1038/nchembio.1810

Xie W, Denman RB

Protein Methylation and Stress Granules: Posttranslational Remodeler or Innocent Bystander?

Mol Biol Int , 2011; 2011:137459. Epub 2011 Feb 24

PubMed ID: 22091395 DOI: 10.4061/2011/137459

Did we miss your publication?

Have you published using HPA001170? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch