Anti-SLCO5A1 Antibody

solute carrier organic anion transporter family, member 5A1
Recommended Applications
Product Description
Polyclonal Antibody against Human SLCO5A1
Alternative Gene Names
OATP-J, OATP5A1, OATPRP4, SLC21A15
Price
$450.00
Product Number
HPA025062
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
solute carrier organic anion transporter family, member 5A1
Target Gene
SLCO5A1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRDLPRAAVRILSNM
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000008966 (83%)

Mouse ENSMUSG00000025938 (79%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
Protein Name
solute carrier organic anion transporter family, member 5A1
Gene Name
SLCO5A1
Alternative Gene Names
OATP-J, OATP5A1, OATPRP4, SLC21A15
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000137571 on the Human Protein Atlas

Patik I, Kovacsics D, Német O, Gera M, Várady G, Stieger B, Hagenbuch B, Szakács G, Özvegy-Laczka C

Functional expression of the 11 human Organic Anion Transporting Polypeptides in insect cells reveals that sodium fluorescein is a general OATP substrate.

Biochem Pharmacol , 2015 Dec 15; 98(4):649-58

PubMed ID: 26415544 DOI: 10.1016/j.bcp.2015.09.015

Olszewski-Hamilton U, Svoboda M, Thalhammer T, Buxhofer-Ausch V, Geissler K, Hamilton G

Organic Anion Transporting Polypeptide 5A1 (OATP5A1) in Small Cell Lung Cancer (SCLC) Cells: Possible Involvement in Chemoresistance to Satraplatin

Biomark Cancer , 2011; 3:31-40. Epub 2011 Jun 7

PubMed ID: 24179389 DOI: 10.4137/BIC.S7151

Did we miss your publication?

Have you published using HPA025062? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch