Enhanced Validation

Anti-SLCO1B3 Antibody

solute carrier organic anion transporter family, member 1B3
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human SLCO1B3
Alternative Gene Names
OATP1B3, OATP8, SLC21A8
Price
$445.00
Product Number
HPA004943
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
solute carrier organic anion transporter family, member 1B3
Target Gene
SLCO1B3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000030236 (33%)

Rat ENSRNOG00000015835 (32%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
solute carrier organic anion transporter family, member 1B3
Gene Name
SLCO1B3
Alternative Gene Names
OATP1B3, OATP8, SLC21A8
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000111700 on the Human Protein Atlas

Park SH, Kim H, Kim EK, Kim H, Choi DK, Chung YE, Kim MJ, Choi JY

Aberrant expression of OATP1B3 in colorectal cancer liver metastases and its clinical implication on gadoxetic acid-enhanced MRI

Oncotarget , 2017 Aug 16; 8(41):71012-71023. Epub 2017 Aug 16

PubMed ID: 29050339 DOI: 10.18632/oncotarget.20295

Kagawa T, Adachi Y, Hashimoto N, Mitsui H, Ohashi T, Yoneda M, Hasegawa I, Hirose S, Tsuruya K, Anzai K, Mine T

Loss of organic anion transporting polypeptide 1B3 function causes marked delay in indocyanine green clearance without any clinical symptoms

Hepatology , 2017 Jan 6; 65(3):1065-1068. Epub 2017 Jan 6

PubMed ID: 27863442 DOI: 10.1002/hep.28950

Sun Y, Furihata T, Ishii S, Nagai M, Harada M, Shimozato O, Kamijo T, Motohashi S, Yoshino I, Kamiichi A, Kobayashi K, Chiba K

Unique expression features of cancer-type organic anion transporting polypeptide 1B3 mRNA expression in human colon and lung cancers

Clin Transl Med , 2014; 3:37. Epub 2014 Nov 18

PubMed ID: 25625007 DOI: 10.1186/s40169-014-0037-y

Kounnis V, Ioachim E, Svoboda M, Tzakos A, Sainis I, Thalhammer T, Steiner G, Briasoulis E

Expression of organic anion-transporting polypeptides 1B3, 1B1, and 1A2 in human pancreatic cancer reveals a new class of potential therapeutic targets.

Onco Targets Ther , 2011 Apr 8; 4:27-32. Epub 2011 Apr 8

PubMed ID: 21552413 DOI: 10.2147/OTT.S16706

Did we miss your publication?

Have you published using HPA004943? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch