1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-SLC16A1
Enhanced Validation

Anti-SLC16A1 Antibody

solute carrier family 16 (monocarboxylate transporter), member 1
References (3)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human SLC16A1
Alternative Gene Names
MCT, MCT1
Open Datasheet
Price
$450.00
Product Number
HPA003324
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human testis and pancreas tissues using HPA003324 antibody. Corresponding SLC16A1 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in human cell lines HEK293 and MCF-7 using Anti-SLC16A1 antibody. Corresponding SLC16A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
solute carrier family 16 (monocarboxylate transporter), member 1
Target Gene
SLC16A1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGF
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000032902 (66%)

Rat ENSRNOG00000019996 (65%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA003324 on the Human Protein Atlas
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA003324 on the Human Protein Atlas
Protein Name
solute carrier family 16 (monocarboxylate transporter), member 1
Gene Name
SLC16A1
Alternative Gene Names
MCT, MCT1
UniProt ID
P53985
Gene (Ensembl)
ENSG00000155380
Entrez Gene ID
Entrez gene: 6566
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000155380 on the Human Protein Atlas

Hashimoto M, Girardi E, Eichner R, Superti-Furga G

Detection of Chemical Engagement of Solute Carrier Proteins by a Cellular Thermal Shift Assay

ACS Chem Biol , 2018 May 31; 13(6):1480-1486. Epub 2018 May 31

PubMed ID: 29851333 DOI: 10.1021/acschembio.8b00270

Saini JS, Corneo B, Miller JD, Kiehl TR, Wang Q, Boles NC, Blenkinsop TA, Stern JH, Temple S

Nicotinamide Ameliorates Disease Phenotypes in a Human iPSC Model of Age-related Macular Degeneration

Cell Stem Cell , 2017 Jan 26; 20(5):635-647.e7. Epub 2017 Jan 26

PubMed ID: 28132833 DOI: 10.1016/j.stem.2016.12.015

Did we miss your publication?

Have you published using HPA003324? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-SLC16A1 (HPA071055)
Corresponding Antigens
PrEST Antigen SLC16A1 (APrEST86072)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-SLC16A1