Enhanced Validation

Anti-SLC12A3 Antibody

solute carrier family 12 (sodium/chloride transporter), member 3
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SLC12A3
Alternative Gene Names
NCCT
Price
$445.00
Product Number
HPA028748
Unit Size
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target Protein
solute carrier family 12 (sodium/chloride transporter), member 3
Target Gene
SLC12A3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000057072 (90%)

Mouse ENSMUSG00000031766 (90%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
solute carrier family 12 (sodium/chloride transporter), member 3
Gene Name
SLC12A3
Alternative Gene Names
NCCT
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000070915 on the Human Protein Atlas

Tsukiyama T, Kobayashi K, Nakaya M, Iwatani C, Seita Y, Tsuchiya H, Matsushita J, Kitajima K, Kawamoto I, Nakagawa T, Fukuda K, Iwakiri T, Izumi H, Itagaki I, Kume S, Maegawa H, Nishinakamura R, Nishio S, Nakamura S, Kawauchi A, Ema M

Monkeys mutant for PKD1 recapitulate human autosomal dominant polycystic kidney disease

Nat Commun , 2019 Dec 11; 10:5517. Epub 2019 Dec 11

PubMed ID: 31822676 DOI: 10.1038/s41467-019-13398-6

Marable SS, Chung E, Adam M, Potter SS, Park JS

Hnf4a deletion in the mouse kidney phenocopies Fanconi renotubular syndrome

JCI Insight , 2018 Jul 25; 3(14):e97497. Epub 2018 Jul 25

PubMed ID: 30046000 DOI: 10.1172/jci.insight.97497

Zhang L, Ettou S, Khalid M, Taglienti M, Jain D, Jung YL, Seager C, Liu Y, Ng KH, Park PJ, Kreidberg JA

EED, a member of the polycomb group, is required for nephron differentiation and the maintenance of nephron progenitor cells

Development , 2018 Jul 18; 145(14):dev157149. Epub 2018 Jul 18

PubMed ID: 29945864 DOI: 10.1242/dev.157149

Magella B, Mahoney R, Adam M, Potter SS

Reduced Abd-B Hox function during kidney development results in lineage infidelity

Dev Biol , 2018 Mar 26; 438(2):84-93. Epub 2018 Mar 26

PubMed ID: 29596840 DOI: 10.1016/j.ydbio.2018.03.020

Lindström NO, Tran T, Guo J, Rutledge E, Parvez RK, Thornton ME, Grubbs B, McMahon JA, McMahon AP

Conserved and Divergent Molecular and Anatomic Features of Human and Mouse Nephron Patterning

J Am Soc Nephrol , 2018 Feb 15; 29(3):825-840. Epub 2018 Feb 15

PubMed ID: 29449451 DOI: 10.1681/ASN.2017091036

Bachmann J, Burté F, Pramana S, Conte I, Brown BJ, Orimadegun AE, Ajetunmobi WA, Afolabi NK, Akinkunmi F, Omokhodion S, Akinbami FO, Shokunbi WA, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk JM, Wahlgren M, Fernandez-Reyes D, Nilsson P

Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria

PLoS Pathog , 2014 Apr; 10(4):e1004038. Epub 2014 Apr 17

PubMed ID: 24743550 DOI: 10.1371/journal.ppat.1004038

Did we miss your publication?

Have you published using HPA028748? Please let us know and we will be happy to include your reference on this page.

Read more

Customer Inquiry, Internal Submission R&D Results

Contribution from Atlas Antibodies, Immunohistochemistry Quality Control Team — March 23, 2016

Customer planned to use the Anti-SLC12A3 antibody (HPA028748) for IHC in human kidney samples and asked if it is the distal kidney tubules or the collecting ducts that are stained by the antibody?

Atlas Antibodies immunohistochemistry QC team performed IHC staining of kidney sections displaying both the kidney medulla and kidney cortex. The existing images on the Human Protein Atlas for the Anti-SLC12A3 antibody (HPA028748) displays tissue cores from the cortex and not the medulla part of the kidney. Distal kidney tubules are present in the cortex and not in the medulla whereas the collecting ducts could be present both in cortex and medulla. In order to make sure if collecting ducts or distal tubules were stained, a section containing both the medulla and cortex was stained with the Anti-SLC12A3 antibody (HPA028748).          

 hpa028748_kidney_cortex_medulla_final   hpa028748_kidney_medulla_zoom1_final  hpa028748_kidney_medulla_zoom3_final

Images show staining of tubules in the cortex part of the kidney and not in the medulla, which supports that the antibody targets distal tubules and not collecting ducts. 

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch