Enhanced Validation

Anti-SLC10A2 Antibody

solute carrier family 10 (sodium/bile acid cotransporter), member 2
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human SLC10A2
Alternative Gene Names
ASBT, ISBT
Price
$445.00
Product Number
HPA004795
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
solute carrier family 10 (sodium/bile acid cotransporter), member 2
Target Gene
SLC10A2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NKAEIPESKENGTEPESSFYKANGGFQPDE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000023073 (47%)

Rat ENSRNOG00000003302 (42%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
solute carrier family 10 (sodium/bile acid cotransporter), member 2
Gene Name
SLC10A2
Alternative Gene Names
ASBT, ISBT
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000125255 on the Human Protein Atlas

Xiao Y, Yan W, Lu Y, Zhou K, Cai W

Neurotensin contributes to pediatric intestinal failure-associated liver disease via regulating intestinal bile acids uptake

EBioMedicine , 2018 Aug 10; 35:133-141. Epub 2018 Aug 10

PubMed ID: 30104181 DOI: 10.1016/j.ebiom.2018.08.006

Did we miss your publication?

Have you published using HPA004795? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch