Enhanced Validation

Polyclonal Anti-SKAP1 Antibody

src kinase associated phosphoprotein 1
References (2)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SKAP1
Alternative Gene Names
SCAP1, SKAP55
Open Datasheet
Price
$505.00
Product Number
HPA002969
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[3 pictures]
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-SKAP1 antibody. Corresponding SKAP1 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line RPTEC TERT1 shows localization to nucleoplasm, plasma membrane & cytosol.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
src kinase associated phosphoprotein 1
Target Gene
SKAP1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000057058 (69%)

Rat ENSRNOG00000023881 (67%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA002969 on the Human Protein Atlas
Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA002969 on the Human Protein Atlas
Protein Name
src kinase associated phosphoprotein 1
Gene Name
SKAP1
Alternative Gene Names
SCAP1, SKAP55
UniProt ID
Q86WV1
Gene (Ensembl)
ENSG00000141293
Entrez Gene ID
Entrez gene: 8631
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000141293 on the Human Protein Atlas

van Doorn R, van Kester MS, Dijkman R, Vermeer MH, Mulder AA, Szuhai K, Knijnenburg J, Boer JM, Willemze R, Tensen CP

Oncogenomic analysis of mycosis fungoides reveals major differences with Sezary syndrome.

Blood , 2009 Jan 1; 113(1):127-36. Epub 2008 Oct 1

PubMed ID: 18832135 DOI: 10.1182/blood-2008-04-153031

Did we miss your publication?

Have you published using HPA002969? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen SKAP1 (APrEST86513)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch