Anti-SETD2 Antibody

SET domain containing 2
Recommended Applications
Product Description
Polyclonal Antibody against Human SETD2
Alternative Gene Names
FLJ23184, HIF-1, HYPB, KIAA1732, KMT3A
Price
$445.00
Product Number
HPA042451
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
SET domain containing 2
Target Gene
SETD2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000044791 (94%)

Rat ENSRNOG00000020915 (92%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
SET domain containing 2
Gene Name
SETD2
Alternative Gene Names
FLJ23184, HIF-1, HYPB, KIAA1732, KMT3A
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000181555 on the Human Protein Atlas

Terzo EA, Lim AR, Chytil A, Chiang YC, Farmer L, Gessner KH, Walker CL, Jansen VM, Rathmell WK

SETD2 loss sensitizes cells to PI3Kβ and AKT inhibition

Oncotarget , 2019 Jan 18; 10(6):647-659. Epub 2019 Jan 18

PubMed ID: 30774762 DOI: 10.18632/oncotarget.26567

Chiang YC, Park IY, Terzo EA, Tripathi DN, Mason FM, Fahey CC, Karki M, Shuster CB, Sohn BH, Chowdhury P, Powell RT, Ohi R, Tsai YS, de Cubas AA, Khan A, Davis IJ, Strahl BD, Parker JS, Dere R, Walker CL, Rathmell WK

SETD2 Haploinsufficiency for Microtubule Methylation is an Early Driver of Genomic Instability in Renal Cell Carcinoma

Cancer Res , 2018 May 3; 78(12):3135-3146. Epub 2018 May 3

PubMed ID: 29724720 DOI: 10.1158/0008-5472.CAN-17-3460

Martinelli G, Mancini M, De Benedittis C, Rondoni M, Papayannidis C, Manfrini M, Meggendorfer M, Calogero R, Guadagnuolo V, Fontana MC, Bavaro L, Padella A, Zago E, Pagano L, Zanotti R, Scaffidi L, Specchia G, Albano F, Merante S, Elena C, Savini P, Gangemi D, Tosi P, Ciceri F, Poletti G, Riccioni L, Morigi F, Delledonne M, Haferlach T, Cavo M, Valent P, Soverini S

SETD2 and histone H3 lysine 36 methylation deficiency in advanced systemic mastocytosis

Leukemia , 2017 Jun 30; 32(1):139-148. Epub 2017 Jun 30

PubMed ID: 28663576 DOI: 10.1038/leu.2017.183

Roberti A, Dobay MP, Bisig B, Vallois D, Boéchat C, Lanitis E, Bouchindhomme B, Parrens MC, Bossard C, Quintanilla-Martinez L, Missiaglia E, Gaulard P, de Leval L

Type II enteropathy-associated T-cell lymphoma features a unique genomic profile with highly recurrent SETD2 alterations

Nat Commun , 2016 Sep 7; 7:12602. Epub 2016 Sep 7

PubMed ID: 27600764 DOI: 10.1038/ncomms12602

Park IY, Chowdhury P, Tripathi DN, Powell RT, Dere R, Terzo EA, Rathmell WK, Walker CL

Methylated α-tubulin antibodies recognize a new microtubule modification on mitotic microtubules

MAbs , 2016 Sep 3; 8(8):1590-1597. Epub 2016 Sep 3

PubMed ID: 27594515 DOI: 10.1080/19420862.2016.1228505

Hacker KE, Fahey CC, Shinsky SA, Chiang YC, DiFiore JV, Jha DK, Vo AH, Shavit JA, Davis IJ, Strahl BD, Rathmell WK

Structure/Function Analysis of Recurrent Mutations in SETD2 Protein Reveals a Critical and Conserved Role for a SET Domain Residue in Maintaining Protein Stability and Histone H3 Lys-36 Trimethylation

J Biol Chem , 2016 Aug 15; 291(40):21283-21295. Epub 2016 Aug 15

PubMed ID: 27528607 DOI: 10.1074/jbc.M116.739375

Kanu N, Grönroos E, Martinez P, Burrell RA, Yi Goh X, Bartkova J, Maya-Mendoza A, Mistrík M, Rowan AJ, Patel H, Rabinowitz A, East P, Wilson G, Santos CR, McGranahan N, Gulati S, Gerlinger M, Birkbak NJ, Joshi T, Alexandrov LB, Stratton MR, Powles T, Matthews N, Bates PA, Stewart A, Szallasi Z, Larkin J, Bartek J, Swanton C

SETD2 loss-of-function promotes renal cancer branched evolution through replication stress and impaired DNA repair

Oncogene , 2015/11/12; 34(46):5699-5708. Epub 2015 Mar 2

PubMed ID: 25728682 DOI: 10.1038/onc.2015.24

Did we miss your publication?

Have you published using HPA042451? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch