Enhanced Validation

Anti-SERPINB5 Antibody

serpin peptidase inhibitor, clade B (ovalbumin), member 5
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human SERPINB5
Alternative Gene Names
maspin, PI5
Price
$450.00
Product Number
HPA020136
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
serpin peptidase inhibitor, clade B (ovalbumin), member 5
Target Gene
SERPINB5
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRVNKT
Verified Species Reactivity
Human, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000002640 (91%)

Mouse ENSMUSG00000067006 (89%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibodies Anti-SERPINB5 HPA019025, Anti-SERPINB5 HPA019132.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Genetic validation in WB by siRNA knockdown.

Protein Name
serpin peptidase inhibitor, clade B (ovalbumin), member 5
Gene Name
SERPINB5
Alternative Gene Names
maspin, PI5
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000206075 on the Human Protein Atlas

Barnabas GD, Bahar-Shany K, Sapoznik S, Helpman L, Kadan Y, Beiner M, Weitzner O, Arbib N, Korach J, Perri T, Katz G, Blecher A, Brandt B, Friedman E, Stockheim D, Jakobson-Setton A, Eitan R, Armon S, Brand H, Zadok O, Aviel-Ronen S, Harel M, Geiger T, Levanon K

Microvesicle Proteomic Profiling of Uterine Liquid Biopsy for Ovarian Cancer Early Detection

Mol Cell Proteomics , 2019 Feb 13; 18(5):865-875. Epub 2019 Feb 13

PubMed ID: 30760538 DOI: 10.1074/mcp.RA119.001362

Did we miss your publication?

Have you published using HPA020136? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch