Enhanced Validation

Anti-SELENOS Antibody

selenoprotein S
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human SELENOS
Alternative Gene Names
AD-015, MGC2553, SBBI8, SELS, SEPS1, VIMP
Price
$445.00
Product Number
HPA010025
Unit Size
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target Protein
selenoprotein S
Target Gene
SELENOS
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000012576 (86%)

Mouse ENSMUSG00000075701 (86%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
selenoprotein S
Gene Name
SELENOS
Alternative Gene Names
AD-015, MGC2553, SBBI8, SELS, SEPS1, VIMP
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000131871 on the Human Protein Atlas

Santos LR, Durães C, Ziros PG, Pestana A, Esteves C, Neves C, Carvalho D, Bongiovanni M, Renaud CO, Chartoumpekis DV, Habeos IG, Simões MS, Soares P, Sykiotis GP

Interaction of Genetic Variations in NFE2L2 and SELENOS Modulates the Risk of Hashimoto's Thyroiditis

Thyroid , 2019 Sep 17; 29(9):1302-1315. Epub 2019 Sep 17

PubMed ID: 31426718 DOI: 10.1089/thy.2018.0480

Cockman EM, Narayan V, Willard B, Shetty SP, Copeland PR, Driscoll DM

Identification of the Selenoprotein S Positive UGA Recoding (SPUR) element and its position-dependent activity

RNA Biol , 2019 Aug 21; 16(12):1682-1696. Epub 2019 Aug 21

PubMed ID: 31432740 DOI: 10.1080/15476286.2019.1653681

Wright CR, Allsopp GL, Addinsall AB, McRae NL, Andrikopoulos S, Stupka N

A Reduction in Selenoprotein S Amplifies the Inflammatory Profile of Fast-Twitch Skeletal Muscle in the mdx Dystrophic Mouse

Mediators Inflamm , 2017 May 16; 2017:7043429. Epub 2017 May 16

PubMed ID: 28592916 DOI: 10.1155/2017/7043429

Touat-Hamici Z, Legrain Y, Bulteau AL, Chavatte L

Selective Up-regulation of Human Selenoproteins in Response to Oxidative Stress

J Biol Chem , 2014 May 23; 289(21):14750-14761. Epub 2014 Apr 4

PubMed ID: 24706762 DOI: 10.1074/jbc.M114.551994

Bubenik JL, Miniard AC, Driscoll DM

Alternative Transcripts and 3′UTR Elements Govern the Incorporation of Selenocysteine into Selenoprotein S

PLoS One , 2013; 8(4):e62102. Epub 2013 Apr 16

PubMed ID: 23614019 DOI: 10.1371/journal.pone.0062102

Paavilainen L, Edvinsson Å, Asplund A, Hober S, Kampf C, Pontén F, Wester K

The Impact of Tissue Fixatives on Morphology and Antibody-based Protein Profiling in Tissues and Cells

J Histochem Cytochem , 2010 Mar; 58(3):237-246

PubMed ID: 19901271 DOI: 10.1369/jhc.2009.954321

Did we miss your publication?

Have you published using HPA010025? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch