Anti-SEC62 Antibody

SEC62 homolog (S. cerevisiae)
Recommended Applications
Product Description
Polyclonal Antibody against Human SEC62
Alternative Gene Names
Dtrp1, HTP1, TLOC1
Price
$445.00
Product Number
HPA014059
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
SEC62 homolog (S. cerevisiae)
Target Gene
SEC62
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000027706 (91%)

Rat ENSRNOG00000009057 (90%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
SEC62 homolog (S. cerevisiae)
Gene Name
SEC62
Alternative Gene Names
Dtrp1, HTP1, TLOC1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000008952 on the Human Protein Atlas

Bhalchandra Jadhav, Michael McKenna, Nicholas Johnson, Stephen High, Irmgard Sinning, Martin R. Pool

Mammalian SRP receptor switches the Sec61 translocase from Sec62 to SRP-dependent translocation

Nature Communications , 6, (2015)

PubMed ID: 26634806 DOI: 10.1038/ncomms10133

Hagerstrand D, Tong A, Schumacher SE, Ilic N, Shen RR, Cheung HW, Vazquez F, Shrestha Y, Kim SY, Giacomelli AO, Rosenbluh J, Schinzel AC, Spardy NA, Barbie DA, Mermel CH, Weir BA, Garraway LA, Tamayo P, Mesirov JP, Beroukhim R, Hahn WC

Systematic interrogation of 3q26 identifies TLOC1 and SKIL as cancer drivers

Cancer Discov , 2013 Sep; 3(9):1044-1057. Epub 2013 Jun 13

PubMed ID: 23764425 DOI: 10.1158/2159-8290.CD-12-0592

Did we miss your publication?

Have you published using HPA014059? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch