Enhanced Validation

Anti-SDHB Antibody

succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human SDHB
Alternative Gene Names
SDH, SDH1
Price
$445.00
Product Number
HPA002868
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Target Gene
SDHB
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000007967 (97%)

Mouse ENSMUSG00000009863 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Gene Name
SDHB
Alternative Gene Names
SDH, SDH1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000117118 on the Human Protein Atlas

Velusamy A, Moonim M, Hubbard J, McGowan B, Powrie J, Izatt L, Obholzer R, Jacques A, Breen L, Carroll P

SUN-344 SDHB Immunostaining: Still an Indispensable Tool in Characterising Pheochromocytoma and Paraganglioma

J Endocr Soc , 2019 Apr 30; 3(Suppl 1):SUN-344. Epub 2019 Apr 30

PubMed ID: 0 DOI: 10.1210/js.2019-SUN-344

Roh TH, Yim H, Roh J, Lee KB, Park SH, Jeong SY, Kim SH, Kim JH

The loss of succinate dehydrogenase B expression is frequently identified in hemangioblastoma of the central nervous system

Sci Rep , 2019 Apr 10; 9:5873. Epub 2019 Apr 10

PubMed ID: 30971719 DOI: 10.1038/s41598-019-42338-z

Richter S, Gieldon L, Pang Y, Peitzsch M, Huynh T, Leton R, Viana B, Ercolino T, Mangelis A, Rapizzi E, Menschikowski M, Aust D, Kroiss M, Beuschlein F, Gudziol V, Timmers HJ, Lenders J, Mannelli M, Cascon A, Pacak K, Robledo M, Eisenhofer G, Klink B

Metabolome-guided genomics to identify mutations in isocitrate dehydrogenase, fumarate hydratase and succinate dehydrogenase genes in pheochromocytoma and paraganglioma

Genet Med , . Epub 2018 Jul 27

PubMed ID: 30050099 DOI: 10.1038/s41436-018-0106-5

Koh JM, Ahn SH, Kim H, Kim BJ, Sung TY, Kim YH, Hong SJ, Song DE, Lee SH

Validation of pathological grading systems for predicting metastatic potential in pheochromocytoma and paraganglioma

PLoS One , 2017 Nov 8; 12(11):e0187398. Epub 2017 Nov 8

PubMed ID: 29117221 DOI: 10.1371/journal.pone.0187398

Cleven AH, Suijker J, Agrogiannis G, Briaire-de Bruijn IH, Frizzell N, Hoekstra AS, Wijers-Koster PM, Cleton-Jansen AM, Bovée JV

IDH1 or -2 mutations do not predict outcome and do not cause loss of 5-hydroxymethylcytosine or altered histone modifications in central chondrosarcomas

Clin Sarcoma Res , 2017 May 4; 7:8. Epub 2017 May 4

PubMed ID: 28484589 DOI: 10.1186/s13569-017-0074-6

Bullova P, Cougnoux A, Abunimer L, Kopacek J, Pastorekova S, Pacak K

Hypoxia potentiates the cytotoxic effect of piperlongumine in pheochromocytoma models

Oncotarget , 2016 May 26; 7(26):40531-40545. Epub 2016 May 26

PubMed ID: 27244895 DOI: 10.18632/oncotarget.9643

Rhein VF, Carroll J, Ding S, Fearnley IM, Walker JE

NDUFAF5 Hydroxylates NDUFS7 at an Early Stage in the Assembly of Human Complex I

J Biol Chem , 2016 May 18; 291(28):14851-14860. Epub 2016 May 18

PubMed ID: 27226634 DOI: 10.1074/jbc.M116.734970

Giubellino A, Lara K, Martucci V, Huynh T, Agarwal P, Pacak K, Merino MJ

Urinary bladder paragangliomas: How Immunohistochemistry can assist to identify patients with SDHB germ line and somatic mutations

Am J Surg Pathol , 2015 Nov; 39(11):1488-1492

PubMed ID: 26457353 DOI: 10.1097/PAS.0000000000000534

Loriot C, Domingues M, Berger A, Menara M, Ruel M, Morin A, Castro-Vega LJ, Letouzé É, Martinelli C, Bemelmans AP, Larue L, Gimenez-Roqueplo AP, Favier J

Deciphering the molecular basis of invasiveness in Sdhb-deficient cells

Oncotarget , 2015 Oct 20; 6(32):32955-32965. Epub 2015 Oct 8

PubMed ID: 26460615 DOI: 10.18632/oncotarget.5106

Desmurs M, Foti M, Raemy E, Vaz FM, Martinou JC, Bairoch A, Lane L

C11orf83, a Mitochondrial Cardiolipin-Binding Protein Involved in bc1 Complex Assembly and Supercomplex Stabilization

Mol Cell Biol , 2015 Apr; 35(7):1139-1156. Epub 2015 Mar 10

PubMed ID: 25605331 DOI: 10.1128/MCB.01047-14

Thomas G Papathomas, Lindsey Oudijk, Alexandre Persu, Anthony J Gill, Francien van Nederveen, Arthur S Tischler, Frédérique Tissier, Marco Volante, Xavier Matias-Guiu, Marcel Smid, Judith Favier, Elena Rapizzi, Rosella Libe, Maria Currás-Freixes, Selda Aydin, Thanh Huynh, Urs Lichtenauer, Anouk van Berkel, Letizia Canu, Rita Domingues, Roderick J Clifton-Bligh, Magdalena Bialas, Miikka Vikkula, Gustavo Baretton, Mauro Papotti, Gabriella Nesi, Cécile Badoual, Karel Pacak, Graeme Eisenhofer, Henri J Timmers, Felix Beuschlein, Jérôme Bertherat, Massimo Mannelli, Mercedes Robledo, Anne-Paule Gimenez-Roqueplo, Winand NM Dinjens, Esther Korpershoek, Ronald R de Krijger

SDHB/SDHA immunohistochemistry in pheochromocytomas and paragangliomas: a multicenter interobserver variation analysis using virtual microscopy: a Multinational Study of the European Network for the Study of Adrenal Tumors (ENS@T)

Modern Pathology , February 27, 2015

PubMed ID: 0 DOI: 10.1038/modpathol.2015.41

Bayley JP, Oldenburg RA, Nuk J, Hoekstra AS, van der Meer CA, Korpershoek E, McGillivray B, Corssmit EP, Dinjens WN, de Krijger RR, Devilee P, Jansen JC, Hes FJ

Paraganglioma and pheochromocytoma upon maternal transmission of SDHD mutations

BMC Med Genet , 2014 Oct 10; 15:111. Epub 2014 Oct 10

PubMed ID: 25300370 DOI: 10.1186/s12881-014-0111-8

Nannini M, Astolfi A, Urbini M, Indio V, Santini D, Heinrich MC, Corless CL, Ceccarelli C, Saponara M, Mandrioli A, Lolli C, Ercolani G, Brandi G, Biasco G, Pantaleo MA

Integrated genomic study of quadruple-WT GIST (KIT/PDGFRA/SDH/RAS pathway wild-type GIST)

BMC Cancer , 2014 Sep 20; 14:685. Epub 2014 Sep 20

PubMed ID: 25239601 DOI: 10.1186/1471-2407-14-685

Haller F, Moskalev EA, Faucz FR, Barthelmeß S, Wiemann S, Bieg M, Assie G, Bertherat J, Schaefer IM, Otto C, Rattenberry E, Maher ER, Ströbel P, Werner M, Carney JA, Hartmann A, Stratakis CA, Agaimy A

Aberrant DNA hypermethylation of SDHC: a novel mechanism of tumor development in Carney triad

Endocr Relat Cancer , 2014/08/01; 21(4):567-577. Epub 2014 May 23

PubMed ID: 24859990 DOI: 10.1530/ERC-14-0254

Jamilloux Y, Favier J, Pertuit M, Delage-Corre M, Lopez S, Teissier MP, Mathonnet M, Galinat S, Barlier A, Archambeaud F

A MEN1 syndrome with a paraganglioma

Eur J Hum Genet , 2014 Feb; 22(2):283-285. Epub 2013 Jun 19

PubMed ID: 23778871 DOI: 10.1038/ejhg.2013.128

Pantaleo MA, Astolfi A, Urbini M, Nannini M, Paterini P, Indio V, Saponara M, Formica S, Ceccarelli C, Casadio R, Rossi G, Bertolini F, Santini D, Pirini MG, Fiorentino M, Basso U, Biasco G

Analysis of all subunits, SDHA, SDHB, SDHC, SDHD, of the succinate dehydrogenase complex in KIT/PDGFRA wild-type GIST

Eur J Hum Genet , 2014 Jan; 22(1):32-39. Epub 2013 Apr 24

PubMed ID: 23612575 DOI: 10.1038/ejhg.2013.80

Cassol CA, Winer D, Liu W, Guo M, Ezzat S, Asa SL

Tyrosine kinase receptors as molecular targets In pheochromocytomas and paragangliomas

Mod Pathol , 2014 Jan 3; 27(8):1050-1062. Epub 2014 Jan 3

PubMed ID: 24390213 DOI: 10.1038/modpathol.2013.233

Rapizzi E, Ercolino T, Canu L, Giaché V, Francalanci M, Pratesi C, Valeri A, Mannelli M

Mitochondrial function and content in pheochromocytoma/paraganglioma of succinate dehydrogenase mutation carriers.

Endocr Relat Cancer , 2012 Jun; 19(3):261-9. Epub 2012 May 3

PubMed ID: 22323561 DOI: 10.1530/ERC-11-0263

Xekouki P, Pacak K, Almeida M, Wassif CA, Rustin P, Nesterova M, de la Luz Sierra M, Matro J, Ball E, Azevedo M, Horvath A, Lyssikatos C, Quezado M, Patronas N, Ferrando B, Pasini B, Lytras A, Tolis G, Stratakis CA

Succinate Dehydrogenase (SDH) D Subunit (SDHD) Inactivation in a Growth-Hormone-Producing Pituitary Tumor: A New Association for SDH?

J Clin Endocrinol Metab , 2012 Mar; 97(3):E357-E366. Epub 2011 Dec 14

PubMed ID: 22170724 DOI: 10.1210/jc.2011-1179

Marchiani S, Tamburrino L, Giuliano L, Nosi D, Sarli V, Gandini L, Piomboni P, Belmonte G, Forti G, Baldi E, Muratori M

Sumo1-ylation of human spermatozoa and its relationship with semen quality.

Int J Androl , 2011 Dec; 34(6 Pt 1):581-93. Epub 2010 Oct 6

PubMed ID: 21039605 DOI: 10.1111/j.1365-2605.2010.01118.x

Gaal J, Stratakis CA, Carney JA, Ball ER, Korpershoek E, Lodish MB, Levy I, Xekouki P, van Nederveen FH, den Bakker MA, O’Sullivan M, Dinjens WN, de Krijger RR

SDHB immunohistochemistry: a useful tool in the diagnosis of Carney–Stratakis and Carney triad gastrointestinal stromal tumors

Mod Pathol , 2011 Jan; 24(1):147-151. Epub 2010 Oct 1

PubMed ID: 20890271 DOI: 10.1038/modpathol.2010.185

Alataki D, Triantafyllidis A, Gaal J, Rodiou C, Vouros J, Papathanasiou A, Papanicolaou A, Rombis V, de Krijger RR

A non-catecholamine-producing sympathetic paraganglioma of the spermatic cord: the importance of performing candidate gene mutation analysis

Virchows Arch , 2010 Nov; 457(5):619-622. Epub 2010 Sep 15

PubMed ID: 20842377 DOI: 10.1007/s00428-010-0966-9

Burnichon N, Brière JJ, Libé R, Vescovo L, Rivière J, Tissier F, Jouanno E, Jeunemaitre X, Bénit P, Tzagoloff A, Rustin P, Bertherat J, Favier J, Gimenez-Roqueplo AP

SDHA is a tumor suppressor gene causing paraganglioma

Hum Mol Genet , 2010 Aug 1; 19(15):3011-3020. Epub 2010 May 18

PubMed ID: 20484225 DOI: 10.1093/hmg/ddq206

Favier J, Brière JJ, Burnichon N, Rivière J, Vescovo L, Benit P, Giscos-Douriez I, De Reyniès A, Bertherat J, Badoual C, Tissier F, Amar L, Libé R, Plouin PF, Jeunemaitre X, Rustin P, Gimenez-Roqueplo AP

The Warburg Effect Is Genetically Determined in Inherited Pheochromocytomas

PLoS One , 2009 Sep 18; 4(9):e7094. Epub 2009 Sep 18

PubMed ID: 19763184 DOI: 10.1371/journal.pone.0007094

van Nederveen FH, Gaal J, Favier J, Korpershoek E, Oldenburg RA, de Bruyn EM, Sleddens HF, Derkx P, Rivière J, Dannenberg H, Petri BJ, Komminoth P, Pacak K, Hop WC, Pollard PJ, Mannelli M, Bayley JP, Perren A, Niemann S, Verhofstad AA, de Bruïne AP, Maher ER, Tissier F, Méatchi T, Badoual C, Bertherat J, Amar L, Alataki D, Van Marck E, Ferrau F, François J, de Herder WW, Peeters MP, van Linge A, Lenders JW, Gimenez-Roqueplo AP, de Krijger RR, Dinjens WN

An immunohistochemical procedure to detect patients with paraganglioma and phaeochromocytoma with germline SDHB, SDHC, or SDHD gene mutations: a retrospective and prospective analysis.

Lancet Oncol , 2009 Aug; 10(8):764-71. Epub 2009 Jul 1

PubMed ID: 19576851 DOI: 10.1016/S1470-2045(09)70164-0

Agarwal G, Rajan S, Valiveru RC, Tulsyan S, Agrawal V, Mittal B, Zaidi G, Mayilvaganan S, Mishra A, Agarwal A, Mishra SK, Bhatia E

Genetic Profile of Indian Pheochromocytoma and Paraganglioma Patients – A Single Institutional Study

Indian J Endocrinol Metab , 2019 Jul-Aug; 23(4):486-490

PubMed ID: 31741911 DOI: 10.4103/ijem.IJEM_163_19

Did we miss your publication?

Have you published using HPA002868? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch