Enhanced Validation

Anti-SCGN Antibody

secretagogin, EF-hand calcium binding protein
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SCGN
Alternative Gene Names
CALBL, DJ501N12.8, SECRET, SEGN
Price
$445.00
Product Number
HPA006641
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
secretagogin, EF-hand calcium binding protein
Target Gene
SCGN
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLK
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000021337 (96%)

Rat ENSRNOG00000016628 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
secretagogin, EF-hand calcium binding protein
Gene Name
SCGN
Alternative Gene Names
CALBL, DJ501N12.8, SECRET, SEGN
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000079689 on the Human Protein Atlas

Sorrells SF, Paredes MF, Velmeshev D, Herranz-Pérez V, Sandoval K, Mayer S, Chang EF, Insausti R, Kriegstein AR, Rubenstein JL, Manuel Garcia-Verdugo J, Huang EJ, Alvarez-Buylla A

Immature excitatory neurons develop during adolescence in the human amygdala

Nat Commun , 2019 Jun 21; 10:2748. Epub 2019 Jun 21

PubMed ID: 31227709 DOI: 10.1038/s41467-019-10765-1

Ellis JK, Sorrells SF, Mikhailova S, Chavali M, Chang S, Sabeur K, Mcquillen P, Rowitch DH

Ferret brain possesses young interneuron collections equivalent to human postnatal migratory streams

J Comp Neurol , 2019 May 15; 527(17):2843-2859. Epub 2019 May 15

PubMed ID: 31050805 DOI: 10.1002/cne.24711

Hansson SF, Zhou AX, Vachet P, Eriksson JW, Pereira MJ, Skrtic S, Jongsma Wallin H, Ericsson-Dahlstrand A, Karlsson D, Ahnmark A, Sörhede Winzell M, Magnone MC, Davidsson P

Secretagogin is increased in plasma from type 2 diabetes patients and potentially reflects stress and islet dysfunction

PLoS One , 2018 Apr 27; 13(4):e0196601. Epub 2018 Apr 27

PubMed ID: 29702679 DOI: 10.1371/journal.pone.0196601

Beier C, Hovhannisyan A, Weiser S, Kung J, Lee S, Lee DY, Huie P, Dalal R, Palanker D, Sher A

Deafferented Adult Rod Bipolar Cells Create New Synapses with Photoreceptors to Restore Vision

J Neurosci , 2017 Apr 26; 37(17):4635-4644

PubMed ID: 28373392 DOI: 10.1523/JNEUROSCI.2570-16.2017

Sanagavarapu K, Weiffert T, Ní Mhurchú N, O’Connell D, Linse S

Calcium Binding and Disulfide Bonds Regulate the Stability of Secretagogin towards Thermal and Urea Denaturation

PLoS One , 2016 Nov 3; 11(11):e0165709. Epub 2016 Nov 3

PubMed ID: 27812162 DOI: 10.1371/journal.pone.0165709

Zhang MD, Tortoriello G, Hsueh B, Tomer R, Ye L, Mitsios N, Borgius L, Grant G, Kiehn O, Watanabe M, Uhlén M, Mulder J, Deisseroth K, Harkany T, Hökfelt TG

Neuronal calcium-binding proteins 1/2 localize to dorsal root ganglia and excitatory spinal neurons and are regulated by nerve injury

Proc Natl Acad Sci U S A , 2014 Mar 25; 111(12):E1149-E1158. Epub 2014 Mar 10

PubMed ID: 24616509 DOI: 10.1073/pnas.1402318111

Gyengesi E, Andrews ZB, Paxinos G, Zaborszky L

Distribution of secretagogin-containing neurons in the basal forebrain of mice, with special reference to the cholinergic corticopetal system

Brain Res Bull , 2013 May; 94:1-8. Epub 2013 Jan 29

PubMed ID: 23376788 DOI: 10.1016/j.brainresbull.2013.01.009

Lindskog C, Korsgren O, Pontén F, Eriksson JW, Johansson L, Danielsson A

Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates.

J Proteomics , 2012 May 17; 75(9):2611-20. Epub 2012 Mar 21

PubMed ID: 22465717 DOI: 10.1016/j.jprot.2012.03.008

Attems J, Alpar A, Spence L, McParland S, Heikenwalder M, Uhlén M, Tanila H, Hökfelt TG, Harkany T

Clusters of secretagogin-expressing neurons in the aged human olfactory tract lack terminal differentiation.

Proc Natl Acad Sci U S A , 2012 Apr 17; 109(16):6259-64. Epub 2012 Apr 2

PubMed ID: 22474393 DOI: 10.1073/pnas.1203843109

Alpár A, Attems J, Mulder J, Hökfelt T, Harkany T

The renaissance of Ca2+-binding proteins in the nervous system: secretagogin takes center stage.

Cell Signal , 2012 Feb; 24(2):378-87. Epub 2011 Oct 1

PubMed ID: 21982882 DOI: 10.1016/j.cellsig.2011.09.028

Mulder J, Spence L, Tortoriello G, DiNieri JA, Uhlén M, Shui B, Kotlikoff MI, Yanagawa Y, Aujard F, Hökfelt T, Hurd YL, Harkany T

Secretagogin is a Ca2+-binding protein identifying prospective extended amygdala neurons in the developing mammalian telencephalon

Eur J Neurosci , 2010 Jun; 31(12):2166-2177. Epub 2010 Jun 7

PubMed ID: 20529129 DOI: 10.1111/j.1460-9568.2010.07275.x

Mulder J, Zilberter M, Spence L, Tortoriello G, Uhlén M, Yanagawa Y, Aujard F, Hökfelt T, Harkany T

Secretagogin is a Ca2+-binding protein specifying subpopulations of telencephalic neurons

Proc Natl Acad Sci U S A , 2009 Dec 29; 106(52):22492-22497. Epub 2009 Dec 16

PubMed ID: 20018755 DOI: 10.1073/pnas.0912484106

Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M

Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics

Mol Cell Proteomics , 2009 Jul; 8(7):1612-1622. Epub 2009 Apr 7

PubMed ID: 19351664 DOI: 10.1074/mcp.M800539-MCP200

Did we miss your publication?

Have you published using HPA006641? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch