Anti-SCD Antibody

stearoyl-CoA desaturase (delta-9-desaturase)
Recommended Applications
Product Description
Polyclonal Antibody against Human SCD
Alternative Gene Names
FADS5, SCDOS
Price
$450.00
Product Number
HPA012107
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
stearoyl-CoA desaturase (delta-9-desaturase)
Target Gene
SCD
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEY
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000025202 (71%)

Rat ENSRNOG00000013552 (68%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
stearoyl-CoA desaturase (delta-9-desaturase)
Gene Name
SCD
Alternative Gene Names
FADS5, SCDOS
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000099194 on the Human Protein Atlas

von Roemeling CA, Caulfield TR, Marlow L, Bok I, Wen J, Miller JL, Hughes R, Hazlehurst L, Pinkerton AB, Radisky DC, Tun HW, Kim YS, Lane AL, Copland JA

Accelerated bottom-up drug design platform enables the discovery of novel stearoyl-CoA desaturase 1 inhibitors for cancer therapy

Oncotarget , 2017 Oct 6; 9(1):3-20. Epub 2017 Oct 6

PubMed ID: 29416592 DOI: 10.18632/oncotarget.21545

von Roemeling CA, Marlow LA, Pinkerton AB, Crist A, Miller J, Tun HW, Smallridge RC, Copland JA

Aberrant Lipid Metabolism in Anaplastic Thyroid Carcinoma Reveals Stearoyl CoA Desaturase 1 as a Novel Therapeutic Target

J Clin Endocrinol Metab , 2015/05/01; 100(5):E697-E709. Epub 2015 Feb 12

PubMed ID: 25675381 DOI: 10.1210/jc.2014-2764

Did we miss your publication?

Have you published using HPA012107? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch