Enhanced Validation

Polyclonal Anti-SATB2 Antibody

SATB homeobox 2
References (3)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SATB2
Alternative Gene Names
FLJ21474, KIAA1034
Open Datasheet
Price
$505.00
Product Number
HPA029543
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[7 pictures]
Immunohistochemistry analysis in human colon and liver tissues using HPA029543 antibody. Corresponding SATB2 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in human cell line K562.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
SATB homeobox 2
Target Gene
SATB2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KECPLSQSMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSPQLSPQLV
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000038331 (100%)

Rat ENSRNOG00000010188 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-SATB2 HPA001042.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA029543 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA029543 on the Human Protein Atlas
Protein Name
SATB homeobox 2
Gene Name
SATB2
Alternative Gene Names
FLJ21474, KIAA1034
UniProt ID
Q9UPW6
Gene (Ensembl)
ENSG00000119042
Entrez Gene ID
Entrez gene: 23314
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000119042 on the Human Protein Atlas

Fazio M, van Rooijen E, Dang M, van de Hoek G, Ablain J, Mito JK, Yang S, Thomas A, Michael J, Fabo T, Modhurima R, Pessina P, Kaufman CK, Zhou Y, White RM, Zon LI

SATB2 induction of a neural crest mesenchyme-like program drives melanoma invasion and drug resistance

eLife , 2021 Feb 2; 10:e64370. Epub 2021 Feb 2

PubMed ID: 33527896 DOI: 10.7554/eLife.64370

Nodin B, Johannesson H, Wangefjord S, O’Connor DP, Lindquist KE, Uhlén M, Jirström K, Eberhard J

Molecular correlates and prognostic significance of SATB1 expression in colorectal cancer

Diagn Pathol , 2012 Aug 30; 7:115. Epub 2012 Aug 30

PubMed ID: 22935204 DOI: 10.1186/1746-1596-7-115

Did we miss your publication?

Have you published using HPA029543? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch