Polyclonal Anti-SASH1 Antibody

SAM and SH3 domain containing 1
Recommended Applications
Product Description
Polyclonal Antibody against Human SASH1
Alternative Gene Names
dJ323M4.1, KIAA0790, SH3D6A
Price
$459.00
Product Number
HPA029947
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
SAM and SH3 domain containing 1
Target Gene
SASH1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LLSAKSSTEPSLKSFSRNQLGNYPTLPLMKSGDALKQGQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCETLEGPQTVDTWPRSH
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000015305 (78%)

Rat ENSRNOG00000013160 (76%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
SAM and SH3 domain containing 1
Gene Name
SASH1
Alternative Gene Names
dJ323M4.1, KIAA0790, SH3D6A
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000111961 on the Human Protein Atlas

Burgess JT, Bolderson E, Adams MN, Duijf PH, Zhang SD, Gray SG, Wright G, Richard DJ, O’Byrne KJ

SASH1 is a prognostic indicator and potential therapeutic target in non-small cell lung cancer

Sci Rep , 2020 Oct 29; 10:18605. Epub 2020 Oct 29

PubMed ID: 33122723 DOI: 10.1038/s41598-020-75625-1

Burgess JT, Bolderson E, Adams MN, Baird AM, Zhang SD, Gately KA, Umezawa K, O'Byrne KJ, Richard DJ

Activation and cleavage of SASH1 by caspase-3 mediates an apoptotic response

Cell Death Dis , 2016 Nov 10; 7(11):e2469-. Epub 2016 Nov 10

PubMed ID: 27831555 DOI: 10.1038/cddis.2016.364

Burgess JT, Bolderson E, Saunus JM, Zhang SD, Reid LE, McNicol AM, Lakhani SR, Cuff K, Richard K, Richard DJ, O'Byrne KJ

SASH1 mediates sensitivity of breast cancer cells to chloropyramine and is associated with prognosis in breast cancer

Oncotarget , 2016 Sep 14; 7(45):72807-72818. Epub 2016 Sep 14

PubMed ID: 27637080 DOI: 10.18632/oncotarget.12020

Did we miss your publication?

Have you published using HPA029947? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch