1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-S100A4
Enhanced Validation

Anti-S100A4 Antibody

S100 calcium binding protein A4
References (6)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human S100A4
Alternative Gene Names
18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98
Open Datasheet
Price
$450.00
Product Number
HPA007973
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using HPA007973 antibody. Corresponding S100A4 RNA-seq data are presented for the same tissues.
Show all images
[2 pictures]
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-S100A4 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
S100 calcium binding protein A4
Target Gene
S100A4
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000001020 (93%)

Rat ENSRNOG00000011821 (91%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA007973 on the Human Protein Atlas
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
S100 calcium binding protein A4
Gene Name
S100A4
Alternative Gene Names
18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98
UniProt ID
P26447
Gene (Ensembl)
ENSG00000196154
Entrez Gene ID
Entrez gene: 6275
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000196154 on the Human Protein Atlas

Hellinger JW, Hüchel S, Goetz L, Bauerschmitz G, Emons G, Gründker C

Inhibition of CYR61-S100A4 Axis Limits Breast Cancer Invasion

Front Oncol , 2019 Oct 23; 9:1074. Epub 2019 Oct 23

PubMed ID: 31709177 DOI: 10.3389/fonc.2019.01074

Agata Zieba, Fredrik Ponten, Mathias Uhlén, Ulf Landegren

In situ protein detection with enhanced specificity using DNA-conjugated antibodies and proximity ligation

Modern Pathology , September 22, 2017

PubMed ID: None DOI: 10.1038/modpathol.2017.102

den Boon JA, Pyeon D, Wang SS, Horswill M, Schiffman M, Sherman M, Zuna RE, Wang Z, Hewitt SM, Pearson R, Schott M, Chung L, He Q, Lambert P, Walker J, Newton MA, Wentzensen N, Ahlquist P

Molecular transitions from papillomavirus infection to cervical precancer and cancer: Role of stromal estrogen receptor signaling

Proc Natl Acad Sci U S A , 2015 Jun 23; 112(25):E3255-E3264. Epub 2015 Jun 8

PubMed ID: 26056290 DOI: 10.1073/pnas.1509322112

Xu X, Tan X, Tampe B, Sanchez E, Zeisberg M, Zeisberg EM

Snail Is a Direct Target of Hypoxia-inducible Factor 1α (HIF1α) in Hypoxia-induced Endothelial to Mesenchymal Transition of Human Coronary Endothelial Cells

J Biol Chem , 2015 May 13; 290(27):16653-16664. Epub 2015 May 13

PubMed ID: 25971970 DOI: 10.1074/jbc.M115.636944

Laguë MN, Detmar J, Paquet M, Boyer A, Richards JS, Adamson SL, Boerboom D

Decidual PTEN expression is required for trophoblast invasion in the mouse

Am J Physiol Endocrinol Metab , 2010 Dec; 299(6):E936-E946. Epub 2010 Sep 21

PubMed ID: 20858757 DOI: 10.1152/ajpendo.00255.2010

Did we miss your publication?

Have you published using HPA007973? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-S100A4