Enhanced Validation

Anti-RUNX2 Antibody

runt-related transcription factor 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human RUNX2
Alternative Gene Names
AML3, CBFA1, CCD, CCD1, PEBP2A1, PEBP2aA1
Price
$445.00
Product Number
HPA022040
Unit Size
Concentration
Lot dependent
Availability
9 in Stock
Ships
Ready to Ship
Target Protein
runt-related transcription factor 2
Target Gene
RUNX2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000039153 (100%)

Rat ENSRNOG00000020193 (81%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
runt-related transcription factor 2
Gene Name
RUNX2
Alternative Gene Names
AML3, CBFA1, CCD, CCD1, PEBP2A1, PEBP2aA1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000124813 on the Human Protein Atlas

Motch Perrine SM, Wu M, Stephens NB, Kriti D, van Bakel H, Jabs EW, Richtsmeier JT

Mandibular dysmorphology due to abnormal embryonic osteogenesis in FGFR2-related craniosynostosis mice

Dis Model Mech , 2019 May 30; 12(5):dmm038513. Epub 2019 May 30

PubMed ID: 31064775 DOI: 10.1242/dmm.038513

Holmes G, O'Rourke C, Motch Perrine SM, Lu N, van Bakel H, Richtsmeier JT, Jabs EW

Midface and upper airway dysgenesis in FGFR2-related craniosynostosis involves multiple tissue-specific and cell cycle effects

Development , 2018 Oct 5; 145(19):dev166488. Epub 2018 Oct 5

PubMed ID: 30228104 DOI: 10.1242/dev.166488

Holmes G, Zhang L, Rivera J, Murphy R, Assouline C, Sullivan L, Oppeneer T, Jabs EW

C-type natriuretic peptide analog treatment of craniosynostosis in a Crouzon syndrome mouse model

PLoS One , 2018 Jul 26; 13(7):e0201492. Epub 2018 Jul 26

PubMed ID: 30048539 DOI: 10.1371/journal.pone.0201492

Castelucci BG, Consonni SR, Rosa VS, Sensiate LA, Delatti PC, Alvares LE, Joazeiro PP

Time-dependent regulation of morphological changes and cartilage differentiation markers in the mouse pubic symphysis during pregnancy and postpartum recovery

PLoS One , 2018 Apr 5; 13(4):e0195304. Epub 2018 Apr 5

PubMed ID: 29621303 DOI: 10.1371/journal.pone.0195304

Schott EM, Farnsworth CW, Grier A, Lillis JA, Soniwala S, Dadourian GH, Bell RD, Doolittle ML, Villani DA, Awad H, Ketz JP, Kamal F, Ackert-Bicknell C, Ashton JM, Gill SR, Mooney RA, Zuscik MJ

Targeting the gut microbiome to treat the osteoarthritis of obesity

JCI Insight , 2018 Apr 19; 3(8):e95997. Epub 2018 Apr 19

PubMed ID: 29669931 DOI: 10.1172/jci.insight.95997

Ferrari N, Riggio AI, Mason S, McDonald L, King A, Higgins T, Rosewell I, Neil JC, Smalley MJ, Sansom OJ, Morris J, Cameron ER, Blyth K

Runx2 contributes to the regenerative potential of the mammary epithelium

Sci Rep , 2015 Oct 22; 5:15658. Epub 2015 Oct 22

PubMed ID: 26489514 DOI: 10.1038/srep15658

Holmes G, van Bakel H, Zhou X, Losic B, Jabs EW

BCL11B expression in intramembranous osteogenesis during murine craniofacial suture development

Gene Expr Patterns , 2015/01/01; 17(1):16-25. Epub 2014 Dec 12

PubMed ID: 25511173 DOI: 10.1016/j.gep.2014.12.001

McDonald L, Ferrari N, Terry A, Bell M, Mohammed ZM, Orange C, Jenkins A, Muller WJ, Gusterson BA, Neil JC, Edwards J, Morris JS, Cameron ER, Blyth K

RUNX2 correlates with subtype-specific breast cancer in a human tissue microarray, and ectopic expression of Runx2 perturbs differentiation in the mouse mammary gland

Dis Model Mech , 2014 May; 7(5):525-534. Epub 2014 Mar 13

PubMed ID: 24626992 DOI: 10.1242/dmm.015040

Martínez-Abadías N, Holmes G, Pankratz T, Wang Y, Zhou X, Jabs EW, Richtsmeier JT

From shape to cells: mouse models reveal mechanisms altering palate development in Apert syndrome

Dis Model Mech , 2013 May; 6(3):768-779. Epub 2013 Mar 8

PubMed ID: 23519026 DOI: 10.1242/dmm.010397

Did we miss your publication?

Have you published using HPA022040? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch