Enhanced Validation

Polyclonal Anti-RSPH4A Antibody

radial spoke head 4 homolog A (Chlamydomonas)
References (8)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human RSPH4A
Alternative Gene Names
CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B
Open Datasheet
Price
$459.00
Product Number
HPA031196
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[3 pictures]
Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-RSPH4A antibody. Corresponding RSPH4A RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A-431 shows localization to nucleus.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
radial spoke head 4 homolog A (Chlamydomonas)
Target Gene
RSPH4A
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSPQSRAKTPLGGPAGPETSSPAPVSPREPSSSP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000039552 (41%)

Rat ENSRNOG00000058561 (37%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA031196 on the Human Protein Atlas
Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA031196 on the Human Protein Atlas
Protein Name
radial spoke head 4 homolog A (Chlamydomonas)
Gene Name
RSPH4A
Alternative Gene Names
CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B
UniProt ID
Q5TD94
Gene (Ensembl)
ENSG00000111834
Entrez Gene ID
Entrez gene: 345895
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000111834 on the Human Protein Atlas

Schultz R, Elenius V, Fassad MR, Freke G, Rogers A, Shoemark A, Koistinen T, Mohamed MA, Lim JS, Mitchison HM, Sironen AI

CFAP300 mutation causing primary ciliary dyskinesia in Finland

Front Genet , 2022 Sep 30; 13:985227. Epub 2022 Sep 30

PubMed ID: 36246608 DOI: 10.3389/fgene.2022.985227

Wang L, Wang R, Yang D, Lu C, Xu Y, Liu Y, Guo T, Lei C, Luo H

Novel RSPH4A Variants Associated With Primary Ciliary Dyskinesia–Related Infertility in Three Chinese Families

Front Genet , 2022 Jun 22; 13:922287. Epub 2022 Jun 22

PubMed ID: 35812741 DOI: 10.3389/fgene.2022.922287

Liu Z, Nguyen QPH, Guan Q, Albulescu A, Erdman L, Mahdaviyeh Y, Kang J, Ouyang H, Hegele RG, Moraes T, Goldenberg A, Dell SD, Mennella V

A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies.

Sci Transl Med , 2020 Mar 18; 12(535)

PubMed ID: 32188719 DOI: 10.1126/scitranslmed.aay0071

Shoemark A, Frost E, Dixon M, Ollosson S, Kilpin K, Patel M, Scully J, Rogers AV, Mitchison HM, Bush A, Hogg C

Accuracy of Immunofluorescence in the Diagnosis of Primary Ciliary Dyskinesia

Am J Respir Crit Care Med , 2017 Jul 1; 196(1):94-101. Epub 2017 Jul 1

PubMed ID: 28199173 DOI: 10.1164/rccm.201607-1351OC

Frommer A, Hjeij R, Loges NT, Edelbusch C, Jahnke C, Raidt J, Werner C, Wallmeier J, Große-Onnebrink J, Olbrich H, Cindrić S, Jaspers M, Boon M, Memari Y, Durbin R, Kolb-Kokocinski A, Sauer S, Marthin JK, Nielsen KG, Amirav I, Elias N, Kerem E, Shoseyov D, Haeffner K, Omran H

Immunofluorescence Analysis and Diagnosis of Primary Ciliary Dyskinesia with Radial Spoke Defects

Am J Respir Cell Mol Biol , 2015 Oct; 53(4):563-573

PubMed ID: 25789548 DOI: 10.1165/rcmb.2014-0483OC

Jeanson L, Copin B, Papon JF, Dastot-Le Moal F, Duquesnoy P, Montantin G, Cadranel J, Corvol H, Coste A, Désir J, Souayah A, Kott E, Collot N, Tissier S, Louis B, Tamalet A, de Blic J, Clement A, Escudier E, Amselem S, Legendre M

RSPH3 Mutations Cause Primary Ciliary Dyskinesia with Central-Complex Defects and a Near Absence of Radial Spokes

Am J Hum Genet , 2015/07/02; 97(1):153-162

PubMed ID: 26073779 DOI: 10.1016/j.ajhg.2015.05.004

Onoufriadis A, Shoemark A, Schmidts M, Patel M, Jimenez G, Liu H, Thomas B, Dixon M, Hirst RA, Rutman A, Burgoyne T, Williams C, Scully J, Bolard F, Lafitte JJ, Beales PL, Hogg C, Yang P, Chung EM, Emes RD, O'Callaghan C, UK10K, Bouvagnet P, Mitchison HM

Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defects

Hum Mol Genet , 2014 Jul 1; 23(13):3362-3374. Epub 2014 Feb 11

PubMed ID: 24518672 DOI: 10.1093/hmg/ddu046

Did we miss your publication?

Have you published using HPA031196? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-RSPH4A (HPA031197)
Anti-RSPH4A (HPA031198)
Corresponding Antigens
PrEST Antigen RSPH4A (APrEST77304)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch