Anti-RHBDD1 Antibody

rhomboid domain containing 1
Recommended Applications
Product Description
Polyclonal Antibody against Human RHBDD1
Alternative Gene Names
DKFZp547E052
Price
$445.00
Product Number
HPA013972
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
rhomboid domain containing 1
Target Gene
RHBDD1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PLKKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFD
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000054963 (73%)

Mouse ENSMUSG00000026142 (70%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
rhomboid domain containing 1
Gene Name
RHBDD1
Alternative Gene Names
DKFZp547E052
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000144468 on the Human Protein Atlas

Freeman M

Spatial proteomics reveal that the protein phosphatase PTP1B interacts with and may modify tyrosine phosphorylation of the rhomboid protease RHBDL4

J Biol Chem , 2019 Jun 7; 294(30):11486-11497. Epub 2019 Jun 7

PubMed ID: 31177093 DOI: 10.1074/jbc.RA118.007074

Paschkowsky S, Hamzé M, Oestereich F, Munter LM

Alternative Processing of the Amyloid Precursor Protein Family by Rhomboid Protease RHBDL4

J Biol Chem , 2016 Aug 25; 291(42):21903-21912. Epub 2016 Aug 25

PubMed ID: 27563067 DOI: 10.1074/jbc.M116.753582

Wan C, Fu J, Wang Y, Miao S, Song W, Wang L

Exosome-Related Multi-Pass Transmembrane Protein TSAP6 Is a Target of Rhomboid Protease RHBDD1-Induced Proteolysis

PLoS One , 2012; 7(5):e37452. Epub 2012 May 18

PubMed ID: 22624035 DOI: 10.1371/journal.pone.0037452

Did we miss your publication?

Have you published using HPA013972? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch