Enhanced Validation

Anti-RECQL5 Antibody

RecQ protein-like 5
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human RECQL5
Alternative Gene Names
FLJ90603, RecQ5
Price
$445.00
Product Number
HPA029971
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
RecQ protein-like 5
Target Gene
RECQL5
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ELEHETFRNAKVANLYKASVLKKVADIHRASKDGQPYDMGGSAKSCSAQAEPPEPNEYDIPPASHVYSLKPKRVGAGFPKGSCPFQTATELMETTRIREQ
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000020752 (73%)

Rat ENSRNOG00000005107 (72%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
RecQ protein-like 5
Gene Name
RECQL5
Alternative Gene Names
FLJ90603, RecQ5
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000108469 on the Human Protein Atlas

Lin Y, Wang H, Wang X, Li M, Chen H, Peng J

Low expression of RecQ-like helicase 5 is associated with poor prognosis in patients with gastric cancer

Oncol Lett , 2019 Nov 21; 19(1):985-991. Epub 2019 Nov 21

PubMed ID: 31897211 DOI: 10.3892/ol.2019.11137

Patterson K, Arya L, Bottomley S, Morgan S, Cox A, Catto J, Bryant HE

Altered RECQL5 expression in urothelial bladder carcinoma increases cellular proliferation and makes RECQL5 helicase activity a novel target for chemotherapy

Oncotarget , 2016 Oct 15; 7(46):76140-76150. Epub 2016 Oct 15

PubMed ID: 27764811 DOI: 10.18632/oncotarget.12683

Arora A, Abdel-Fatah TM, Agarwal D, Doherty R, Croteau DL, Moseley PM, Hameed K, Green A, Aleskandarany MA, Rakha EA, Patterson K, Ball G, Chan SY, Ellis IO, Bohr VA, Bryant HE, Madhusudan S

Clinicopathological and prognostic significance of RECQL5 helicase expression in breast cancers

Carcinogenesis , 2015 Nov 19; 37(1):63-71. Epub 2015 Nov 19

PubMed ID: 26586793 DOI: 10.1093/carcin/bgv163

Lao VV, Welcsh P, Luo Y, Carter KT, Dzieciatkowski S, Dintzis S, Meza J, Sarvetnick NE, Monnat RJ Jr, Loeb LA, Grady WM

Altered RECQ Helicase Expression in Sporadic Primary Colorectal Cancers

Transl Oncol , 2013 Aug; 6(4):458-469. Epub 2013 Aug 1

PubMed ID: 23908689 DOI: 10.1593/tlo.13238

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

Did we miss your publication?

Have you published using HPA029971? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch