Anti-RBM7 Antibody

RNA binding motif protein 7
Recommended Applications
Product Description
Polyclonal Antibody against Human RBM7
Price
$450.00
Product Number
HPA013993
Unit Size
Concentration
Lot dependent
Availability
5 in Stock
Ships
Ready to Ship
Target Protein
RNA binding motif protein 7
Target Gene
RBM7
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQW
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000042396 (79%)

Rat ENSRNOG00000005710 (71%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
RNA binding motif protein 7
Gene Name
RBM7
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000076053 on the Human Protein Atlas

Gable DL, Gaysinskaya V, Atik CC, Talbot CC Jr, Kang B, Stanley SE, Pugh EW, Amat-Codina N, Schenk KM, Arcasoy MO, Brayton C, Florea L, Armanios M

ZCCHC8, the nuclear exosome targeting component, is mutated in familial pulmonary fibrosis and is required for telomerase RNA maturation

Genes Dev , 2019 Oct 1; 33(19-20):1381-1396

PubMed ID: 31488579 DOI: 10.1101/gad.326785.119

Lingaraju M, Johnsen D, Schlundt A, Langer LM, Basquin J, Sattler M, Heick Jensen T, Falk S, Conti E

The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs

Nat Commun , 2019 Jul 29; 10:3393. Epub 2019 Jul 29

PubMed ID: 31358741 DOI: 10.1038/s41467-019-11339-x

Bugai A, Quaresma AJ, Friedel CC, Lenasi T, Düster R, Sibley CR, Fujinaga K, Kukanja P, Hennig T, Blasius M, Geyer M, Ule J, Dölken L, Barborič M

P-TEFb Activation by RBM7 Shapes a Pro-survival Transcriptional Response to Genotoxic Stress

Mol Cell , 2019 Apr 18; 74(2):254-267.e10

PubMed ID: 30824372 DOI: 10.1016/j.molcel.2019.01.033

Lloret-Llinares M, Karadoulama E, Chen Y, Wojenski LA, Villafano GJ, Bornholdt J, Andersson R, Core L, Sandelin A, Jensen TH

The RNA exosome contributes to gene expression regulation during stem cell differentiation

Nucleic Acids Res , 2018 Sep 13; 46(21):11502-11513. Epub 2018 Sep 13

PubMed ID: 30212902 DOI: 10.1093/nar/gky817

Rialdi A, Hultquist J, Morales DJ, Peralta Z, Campisi L, Fenouil R, Moshkina N, Wang ZZ, Laffleur B, Michael R, Haas K, Pefanis E, Albrecht RA, Pache L, Chanda S, Jen J, Ochando J, Byun M, Basu U, Garcia-Sastre A, Krogan N, van Bakel H, Marazzi I

The RNA exosome syncs IAV-RNAPII transcription to promote viral ribogenesis and infectivity.

Cell , 2017 May 4; 169(4):679-692.e14

PubMed ID: 28475896 DOI: 10.1016/j.cell.2017.04.021

Falk S, Finogenova K, Melko M, Benda C, Lykke-Andersen S, Jensen TH, Conti E

Structure of the RBM7–ZCCHC8 core of the NEXT complex reveals connections to splicing factors

Nat Commun , 2016 Dec 1; 7:13573. Epub 2016 Dec 1

PubMed ID: 27905398 DOI: 10.1038/ncomms13573

Did we miss your publication?

Have you published using HPA013993? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch