Enhanced Validation

Polyclonal Anti-RBM47 Antibody

RNA binding motif protein 47
References (4)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human RBM47
Alternative Gene Names
FLJ20273, NET18
Open Datasheet
Price
$505.00
Product Number
HPA006347
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human colon and skeletal muscle tissues using HPA006347 antibody. Corresponding RBM47 RNA-seq data are presented for the same tissues.
Show all images
[2 pictures]
Western blot analysis in human cell lines A-549 and SK-MEL-30 using Anti-RBM47 antibody. Corresponding RBM47 RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
RNA binding motif protein 47
Target Gene
RBM47
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCDPYTLAYYGYPYNALIGPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGGYSAGRGIYSRYHEGKGKQQEKGYELVPNLEIPTVN
Verified Species Reactivity
Human, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000070780 (94%)

Rat ENSRNOG00000002408 (94%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA006347 on the Human Protein Atlas
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA006347 on the Human Protein Atlas
Protein Name
RNA binding motif protein 47
Gene Name
RBM47
Alternative Gene Names
FLJ20273, NET18
UniProt ID
A0AV96
Gene (Ensembl)
ENSG00000163694
Entrez Gene ID
Entrez gene: 54502
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000163694 on the Human Protein Atlas

Li R, Li H, Ge C, Fu Q, Li Z, Jin Y, Tan Q, Zhu Z, Zhang Z, Dong S, Li G, Song X

Increased expression of the RNA-binding motif protein 47 predicts poor prognosis in non-small-cell lung cancer

Oncol Lett , 2020 Feb 20; 19(4):3111-3122. Epub 2020 Feb 20

PubMed ID: 32218862 DOI: 10.3892/ol.2020.11417

T Sakurai, K Isogaya, S Sakai, M Morikawa, Y Morishita, S Ehata, K Miyazono, D Koinuma

RNA-binding motif protein 47 inhibits Nrf2 activity to suppress tumor growth in lung adenocarcinoma

Oncogene , February 29, 2016

PubMed ID: None DOI: 10.1038/onc.2016.35

Vanharanta S, Marney CB, Shu W, Valiente M, Zou Y, Mele A, Darnell RB, Massagué J

Loss of the multifunctional RNA-binding protein RBM47 as a source of selectable metastatic traits in breast cancer

eLife , 2014 Jun 4; 3:e02734. Epub 2014 Jun 4

PubMed ID: 24898756 DOI: 10.7554/eLife.02734

Did we miss your publication?

Have you published using HPA006347? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen RBM47 (APrEST86761)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch