Anti-RBM45 Antibody

RNA binding motif protein 45
Recommended Applications
Product Description
Polyclonal Antibody against Human RBM45
Alternative Gene Names
DRB1, FLJ44612
Price
$450.00
Product Number
HPA020448
Unit Size
Concentration
Lot dependent
Availability
4 in Stock
Ships
Ready to Ship
Target Protein
RNA binding motif protein 45
Target Gene
RBM45
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIPKSYTEE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000010595 (98%)

Mouse ENSMUSG00000042369 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
RNA binding motif protein 45
Gene Name
RBM45
Alternative Gene Names
DRB1, FLJ44612
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000155636 on the Human Protein Atlas

Wei C, Stock L, Valanejad L, Zalewski ZA, Karns R, Puymirat J, Nelson D, Witte D, Woodgett J, Timchenko NA, Timchenko L

Correction of GSK3β at young age prevents muscle pathology in mice with myotonic dystrophy type 1

FASEB J , 2018 Jan 5; 32(4):2073-2085. Epub 2018 Jan 5

PubMed ID: 29203592 DOI: 10.1096/fj.201700700R

Bakkar N, Kousari A, Kovalik T, Li Y, Bowser R

RBM45 Modulates the Antioxidant Response in Amyotrophic Lateral Sclerosis through Interactions with KEAP1

Mol Cell Biol , 2015/07/01; 35(14):2385-2399. Epub 2015 Jun 19

PubMed ID: 25939382 DOI: 10.1128/MCB.00087-15

Collins M, Riascos D, Kovalik T, An J, Krupa K, Krupa K, Hood BL, Conrads TP, Renton AE, Traynor BJ, Bowser R

The RNA-binding motif 45 (RBM45) protein accumulates in inclusion bodies in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP) patients

Acta Neuropathol , 2012 Nov; 124(5):717-732. Epub 2012 Sep 21

PubMed ID: 22993125 DOI: 10.1007/s00401-012-1045-x

Did we miss your publication?

Have you published using HPA020448? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch