1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-RBM39
Enhanced Validation

Anti-RBM39 Antibody

RNA binding motif protein 39
References (4)
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human RBM39
Alternative Gene Names
CAPER, CAPERalpha, CC1.3, fSAP59, HCC1, RNPC2
Open Datasheet
Price
$445.00
Product Number
HPA001591
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human cervix, uterine shows moderate nuclear positivity in keratinocytes.
Show all images
[1 pictures]
Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-RBM39 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear speckles & microtubules.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
RNA binding motif protein 39
Target Gene
RBM39
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000027620 (100%)

Rat ENSRNOG00000049814 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA001591 on the Human Protein Atlas
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA001591 on the Human Protein Atlas
Protein Name
RNA binding motif protein 39
Gene Name
RBM39
Alternative Gene Names
CAPER, CAPERalpha, CC1.3, fSAP59, HCC1, RNPC2
UniProt ID
Q14498
Gene (Ensembl)
ENSG00000131051
Entrez Gene ID
Entrez gene: 9584
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000131051 on the Human Protein Atlas

Lu G, Weng S, Matyskiela M, Zheng X, Fang W, Wood S, Surka C, Mizukoshi R, Lu CC, Mendy D, Jang IS, Wang K, Marella M, Couto S, Cathers B, Carmichael J, Chamberlain P, Rolfe M

UBE2G1 governs the destruction of cereblon neomorphic substrates

eLife , 2018 Sep 20; 7:e40958. Epub 2018 Sep 20

PubMed ID: 30234487 DOI: 10.7554/eLife.40958

Faherty N, Benson M, Sharma E, Lee A, Howarth A, Lockstone H, Ebner D, Bhattacharya S

Negative autoregulation of BMP dependent transcription by SIN3B splicing reveals a role for RBM39

Sci Rep , 2016 Jun 21; 6:28210. Epub 2016 Jun 21

PubMed ID: 27324164 DOI: 10.1038/srep28210

Sillars-Hardebol AH, Carvalho B, Beliën JA, de Wit M, Delis-van Diemen PM, Tijssen M, van de Wiel MA, Pontén F, Meijer GA, Fijneman RJ

CSE1L, DIDO1 and RBM39 in colorectal adenoma to carcinoma progression.

Cell Oncol (Dordr) , 2012 Aug; 35(4):293-300. Epub 2012 Jun 19

PubMed ID: 22711543 DOI: 10.1007/s13402-012-0088-2

Did we miss your publication?

Have you published using HPA001591? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens
PrEST Antigen RBM39 (APrEST74298)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-RBM39