Enhanced Validation

Anti-RBM3 Antibody

RNA binding motif (RNP1, RRM) protein 3
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human RBM3
Alternative Gene Names
IS1-RNPL
Price
$445.00
Product Number
HPA003624
Unit Size
100 µl
Concentration
Lot dependent
Availability
5 in Stock
Ships
Ready to Ship
Target Protein
RNA binding motif (RNP1, RRM) protein 3
Target Gene
RBM3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000005387 (96%)

Mouse ENSMUSG00000031167 (94%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
RNA binding motif (RNP1, RRM) protein 3
Gene Name
RBM3
Alternative Gene Names
IS1-RNPL
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000102317 on the Human Protein Atlas

Grupp K, Hofmann B, Kutup A, Bachmann K, Bogoevski D, Melling N, Uzunoglu FG, El Gammal AT, Koop C, Simon R, Steurer S, Krech T, Burdak-Rothkamm S, Jacobsen F, Sauter G, Izbicki J, Wilczak W

Reduced RBM3 expression is associated with aggressive tumor features in esophageal cancer but not significantly linked to patient outcome

BMC Cancer , 2018 Nov 12; 18:1106. Epub 2018 Nov 12

PubMed ID: 30419865 DOI: 10.1186/s12885-018-5032-z

Kang SH, Cho J, Jeong H, Kwon SY

High RNA-binding Motif Protein 3 Expression Is Associated with Improved Clinical Outcomes in Invasive Breast Cancer

J Breast Cancer , 2018 Aug 28; 21(3):288-296. Epub 2018 Aug 28

PubMed ID: 30275857 DOI: 10.4048/jbc.2018.21.e34

Hjelm B, Brennan DJ, Zendehrokh N, Eberhard J, Nodin B, Gaber A, Pontén F, Johannesson H, Smaragdi K, Frantz C, Hober S, Johnson LB, Påhlman S, Jirström K, Uhlen M

High nuclear RBM3 expression is associated with an improved prognosis in colorectal cancer.

Proteomics Clin Appl , 2011 Dec; 5(11-12):624-35

PubMed ID: 21956899 DOI: 10.1002/prca.201100020

Hjelm B, Forsström B, Igel U, Johannesson H, Stadler C, Lundberg E, Ponten F, Sjöberg A, Rockberg J, Schwenk JM, Nilsson P, Johansson C, Uhlén M

Generation of monospecific antibodies based on affinity capture of polyclonal antibodies.

Protein Sci , 2011 Nov; 20(11):1824-35. Epub 2011 Oct 12

PubMed ID: 21898641 DOI: 10.1002/pro.716

Jögi A, Brennan DJ, Rydén L, Magnusson K, Fernö M, Stål O, Borgquist S, Uhlen M, Landberg G, Påhlman S, Pontén F, Jirström K

Nuclear expression of the RNA-binding protein RBM3 is associated with an improved clinical outcome in breast cancer.

Mod Pathol , 2009 Dec; 22(12):1564-74. Epub 2009 Sep 4

PubMed ID: 19734850 DOI: 10.1038/modpathol.2009.124

Did we miss your publication?

Have you published using HPA003624? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch