Enhanced Validation

Polyclonal Anti-RBCK1 Antibody

RanBP-type and C3HC4-type zinc finger containing 1
Recommended Applications
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human RBCK1
Alternative Gene Names
C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP4, ZRANB4
Price
$459.00
Product Number
HPA024185
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
RanBP-type and C3HC4-type zinc finger containing 1
Target Gene
RBCK1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000006695 (88%)

Mouse ENSMUSG00000027466 (87%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
RanBP-type and C3HC4-type zinc finger containing 1
Gene Name
RBCK1
Alternative Gene Names
C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP4, ZRANB4
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000125826 on the Human Protein Atlas

Kelsall IR, McCrory EH, Xu Y, Scudamore CL, Nanda SK, Mancebo‐Gamella P, Wood NT, Knebel A, Matthews SJ, Cohen P

HOIL‐1 ubiquitin ligase activity targets unbranched glucosaccharides and is required to prevent polyglucosan accumulation

EMBO J , 2022 Mar 11; 41(8):e109700. Epub 2022 Mar 11

PubMed ID: 35274759 DOI: 10.15252/embj.2021109700

Bao W, Sun C, Sun X, He M, Yu H, Yan W, Wen F, Zhang L, Yang C

Targeting BCL10 by small peptides for the treatment of B cell lymphoma

Theranostics , 2020 Sep 19; 10(25):11622-11636. Epub 2020 Sep 19

PubMed ID: 33052237 DOI: 10.7150/thno.47533

Strickson S, Emmerich CH, Goh ET, Zhang J, Kelsall IR, Macartney T, Hastie CJ, Knebel A, Peggie M, Marchesi F, Arthur JS, Cohen P

Roles of the TRAF6 and Pellino E3 ligases in MyD88 and RANKL signaling

Proc Natl Acad Sci U S A , 2017 Apr 12; 114(17):E3481-E3489. Epub 2017 Apr 12

PubMed ID: 28404732 DOI: 10.1073/pnas.1702367114

Maarten F. de Jong, Zixu Liu, Didi Chen, Neal M. Alto

Shigella flexneri suppresses NF-κB activation by inhibiting linear ubiquitin chain ligation

Nature Microbiology , May 27, 2016

PubMed ID: None DOI: 10.1038/nmicrobiol.2016.84

de Jong MF, Liu Z, Chen D, Alto NM

Shigella flexneri suppresses NF-kB activation by inhibiting linear ubiquitin chain ligation

Nat Microbiol , 2016 May 27; 1(7):16084. Epub 2016 May 27

PubMed ID: 27572974 DOI: 10.1038/nmicrobiol.2016.84

Klein T, Fung SY, Renner F, Blank MA, Dufour A, Kang S, Bolger-Munro M, Scurll JM, Priatel JJ, Schweigler P, Melkko S, Gold MR, Viner RI, Régnier CH, Turvey SE, Overall CM

The paracaspase MALT1 cleaves HOIL1 reducing linear ubiquitination by LUBAC to dampen lymphocyte NF-κB signalling

Nat Commun , 2015 Nov 3; 6:8777. Epub 2015 Nov 3

PubMed ID: 26525107 DOI: 10.1038/ncomms9777

Lewis MJ, Vyse S, Shields AM, Boeltz S, Gordon PA, Spector TD, Lehner PJ, Walczak H, Vyse TJ

UBE2L3 Polymorphism Amplifies NF-κB Activation and Promotes Plasma Cell Development, Linking Linear Ubiquitination to Multiple Autoimmune Diseases

Am J Hum Genet , 2015 Feb 5; 96(2):221-234

PubMed ID: 25640675 DOI: 10.1016/j.ajhg.2014.12.024

Did we miss your publication?

Have you published using HPA024185? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch