Enhanced Validation

Polyclonal Anti-PYGB Antibody

phosphorylase, glycogen; brain
Recommended Applications
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human PYGB
Price
$459.00
Product Number
HPA031067
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
phosphorylase, glycogen; brain
Target Gene
PYGB
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GTMDGANVEMAEEAGAENLFIFGLRVEDVEALDRKGYNAREYYDHLPELKQAVDQISSGFFSPKEPDCFKDIVNMLMHHDRFKVFADYEAYMQCQAQVDQLYRNPKEWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPSDLQIPP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000033059 (91%)

Rat ENSRNOG00000021090 (76%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
phosphorylase, glycogen; brain
Gene Name
PYGB
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000100994 on the Human Protein Atlas

Zois CE, Hendriks AM, Haider S, Pires E, Bridges E, Kalamida D, Voukantsis D, Lagerholm BC, Fehrmann RS, den Dunnen WF, Tarasov AI, Baba O, Morris J, Buffa FM, McCullagh JS, Jalving M, Harris AL

Liver glycogen phosphorylase is upregulated in glioblastoma and provides a metabolic vulnerability to high dose radiation

Cell Death Dis , 2022 Jun 28; 13(6):573. Epub 2022 Jun 28

PubMed ID: 35764612 DOI: 10.1038/s41419-022-05005-2

García-Consuegra I, Asensio-Peña S, Garrido-Moraga R, Pinós T, Domínguez-González C, Santalla A, Nogales-Gadea G, Serrano-Lorenzo P, Andreu AL, Arenas J, Zugaza JL, Lucia A, Martín MA

Identification of Potential Muscle Biomarkers in McArdle Disease: Insights from Muscle Proteome Analysis

Int J Mol Sci , 2022 Apr 22; 23(9):4650. Epub 2022 Apr 22

PubMed ID: 35563042 DOI: 10.3390/ijms23094650

Jung M, Lee C, Han D, Kim K, Yang S, Nikas IP, Moon KC, Kim H, Song MJ, Kim B, Lee H, Ryu HS

Proteomic-Based Machine Learning Analysis Reveals PYGB as a Novel Immunohistochemical Biomarker to Distinguish Inverted Urothelial Papilloma From Low-Grade Papillary Urothelial Carcinoma With Inverted Growth

Front Oncol , 2022 Mar 24; 12:841398. Epub 2022 Mar 24

PubMed ID: 35402263 DOI: 10.3389/fonc.2022.841398

Zhu Y, Fan Z, Zhao Q, Li J, Cai G, Wang R, Liang Y, Lu N, Kang J, Luo D, Tao H, Li Y, Huang J, Wu S

Brain-Type Glycogen Phosphorylase Is Crucial for Astrocytic Glycogen Accumulation in Chronic Social Defeat Stress-Induced Depression in Mice

Front Mol Neurosci , 2022 Jan 24; 14:819440. Epub 2022 Jan 24

PubMed ID: 35140588 DOI: 10.3389/fnmol.2021.819440

Fan Z, Zhang Z, Zhao S, Zhu Y, Guo D, Yang B, Zhuo L, Han J, Wang R, Fang Z, Dong H, Li Y, Xiong L

Dynamic Variations in Brain Glycogen are Involved in Modulating Isoflurane Anesthesia in Mice

Neurosci Bull , 2020 Oct 13; 36(12):1513-1523. Epub 2020 Oct 13

PubMed ID: 33048310 DOI: 10.1007/s12264-020-00587-3

Did we miss your publication?

Have you published using HPA031067? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch