Enhanced Validation

Anti-PTPN6 Antibody

protein tyrosine phosphatase, non-receptor type 6
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human PTPN6
Alternative Gene Names
HCP, HCPH, PTP-1C, SHP-1, SHP1
Price
$437.00
Product Number
HPA001466
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
protein tyrosine phosphatase, non-receptor type 6
Target gene
PTPN6
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLK
Verified Species Reactivity
Human, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000004266 (92%)

Rat ENSRNOG00000014294 (91%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
protein tyrosine phosphatase, non-receptor type 6
Gene Name
PTPN6
Alternative Gene Names
HCP, HCPH, PTP-1C, SHP-1, SHP1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000111679 on the Human Protein Atlas

Roland Lehmann, Mario M Müller, Tilman E Klassert, Dominik Driesch, Magdalena Stock, Anina Heinrich, Theresia Conrad, Christoph Moore, Uta K Schier, Reinhard Guthke, Hortense Slevogt

Differential regulation of the transcriptomic and secretomic landscape of sensor and effector functions of human airway epithelial cells

Mucosal Immunology , January 03, 2018

DOI: 10.1038/mi.2017.100

McKenzie RC, Jones CL, Tosi I, Caesar JA, Whittaker SJ, Mitchell TJ

Constitutive activation of STAT3 in Sézary syndrome is independent of SHP-1.

Leukemia , 2012 Feb; 26(2):323-31. Epub 2011 Aug 5

PubMed ID: 21818116 DOI: 10.1038/leu.2011.198

Did we miss your publication?

Have you published using HPA001466? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens