Anti-PTPN12 Antibody

protein tyrosine phosphatase, non-receptor type 12
Recommended Applications
Product Description
Polyclonal Antibody against Human PTPN12
Alternative Gene Names
PTP-PEST, PTPG1
Price
$445.00
Product Number
HPA007097
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
protein tyrosine phosphatase, non-receptor type 12
Target Gene
PTPN12
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHGPENAIPIPDLSEGNSSDINYQTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNPLHSDDSDSDERNSDGAVTQNKTNISTASATVSAAT
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000013135 (64%)

Mouse ENSMUSG00000028771 (63%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
protein tyrosine phosphatase, non-receptor type 12
Gene Name
PTPN12
Alternative Gene Names
PTP-PEST, PTPG1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000127947 on the Human Protein Atlas

Weidemann SA, Sauer C, Luebke AM, Möller-Koop C, Steurer S, Hube-Magg C, Büscheck F, Höflmayer D, Tsourlakis MC, Clauditz TS, Simon R, Sauter G, Göbel C, Lebok P, Dum D, Fraune C, Kind S, Minner S, Izbicki J, Schlomm T, Huland H, Heinzer H, Burandt E, Haese A, Graefen M, Heumann A

High-level expression of protein tyrosine phosphatase non-receptor 12 is a strong and independent predictor of poor prognosis in prostate cancer

BMC Cancer , 2019 Oct 12; 19:944. Epub 2019 Oct 12

PubMed ID: 31606028 DOI: 10.1186/s12885-019-6182-3

Cao X, Chen YZ, Luo RZ, Zhang L, Zhang SL, Zeng J, Jiang YC, Han YJ, Wen ZS

Tyrosine-protein phosphatase non-receptor type 12 expression is a good prognostic factor in resectable non-small cell lung cancer

Oncotarget , 2015 May 10; 6(13):11704-11713. Epub 2015 Mar 14

PubMed ID: 25868976 DOI: 10.18632/oncotarget.3588

Harris IS, Blaser H, Moreno J, Treloar AE, Gorrini C, Sasaki M, Mason JM, Knobbe CB, Rufini A, Hallé M, Elia AJ, Wakeham A, Tremblay ML, Melino G, Done S, Mak TW

PTPN12 promotes resistance to oxidative stress and supports tumorigenesis by regulating FOXO signaling.

Oncogene , 2014 Feb 20; 33(8):1047-54. Epub 2013 Feb 25

PubMed ID: 23435421 DOI: 10.1038/onc.2013.24

Did we miss your publication?

Have you published using HPA007097? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch