Enhanced Validation

Polyclonal Anti-PTGS1 Antibody

prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
References (5)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human PTGS1
Alternative Gene Names
COX1, PGHS-1, PTGHS
Open Datasheet
Price
$505.00
Product Number
HPA002834
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[3 pictures]
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-PTGS1 antibody. Corresponding PTGS1 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in human cell line HEL.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line BJ shows localization to the Golgi apparatus.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
Target Gene
PTGS1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGN
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000047250 (93%)

Rat ENSRNOG00000007415 (90%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA002834 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA002834 on the Human Protein Atlas
Protein Name
prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
Gene Name
PTGS1
Alternative Gene Names
COX1, PGHS-1, PTGHS
UniProt ID
P23219
Gene (Ensembl)
ENSG00000095303
Entrez Gene ID
Entrez gene: 5742
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000095303 on the Human Protein Atlas

Sparreman Mikus M, Kolmert J, Andersson LI, Östling J, Knowles RG, Gómez C, Ericsson M, Thörngren JO, Emami Khoonsari P, Dahlén B, Kupczyk M, De Meulder B, Auffray C, Bakke PS, Beghe B, Bel EH, Caruso M, Chanez P, Chawes B, Fowler SJ, Gaga M, Geiser T, Gjomarkaj M, Horváth I, Howarth PH, Johnston SL, Joos G, Krug N, Montuschi P, Musial J, Niżankowska-Mogilnicka E, Olsson HK, Papi A, Rabe KF, Sandström T, Shaw DE, Siafakas NM, Uhlén M, Riley JH, Bates S, Middelveld RJ, Wheelock CE, Chung KF, Adcock IM, Sterk PJ, Djukanovic R, Nilsson P, Dahlén SE, James A

Plasma proteins elevated in severe asthma despite oral steroid use and unrelated to Type-2 inflammation

Eur Respir J , 2022 Feb 17; 59(2):2100142. Epub 2022 Feb 17

PubMed ID: 34737220 DOI: 10.1183/13993003.00142-2021

Shao W, Kuhn C, Mayr D, Ditsch N, Kailuwait M, Wolf V, Harbeck N, Mahner S, Jeschke U, Cavaillès V, Sixou S

Cytoplasmic PPARγ is a marker of poor prognosis in patients with Cox-1 negative primary breast cancers

J Transl Med , 2020 Feb 21; 18:94. Epub 2020 Feb 21

PubMed ID: 32085795 DOI: 10.1186/s12967-020-02271-6

Ayiomamitis GD, Notas G, Vasilakaki T, Tsavari A, Vederaki S, Theodosopoulos T, Kouroumalis E, Zaravinos A

Understanding the Interplay between COX-2 and hTERT in Colorectal Cancer Using a Multi-Omics Analysis

Cancers (Basel) , 2019 Oct 11; 11(10):1536. Epub 2019 Oct 11

PubMed ID: 31614548 DOI: 10.3390/cancers11101536

Asplund A, Gry Björklund M, Sundquist C, Strömberg S, Edlund K, Ostman A, Nilsson P, Pontén F, Lundeberg J

Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma.

Br J Dermatol , 2008 Mar; 158(3):527-38. Epub 2008 Jan 30

PubMed ID: 18241271 DOI: 10.1111/j.1365-2133.2007.08418.x

Did we miss your publication?

Have you published using HPA002834? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen PTGS1 (APrEST83040)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch