Anti-PSMD14 Antibody

proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Recommended Applications
Product Description
Polyclonal Antibody against Human PSMD14
Alternative Gene Names
pad1, POH1, Rpn11
Price
$445.00
Product Number
HPA002114
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Target Gene
PSMD14
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDA
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000026914 (100%)

Rat ENSRNOG00000061129 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Gene Name
PSMD14
Alternative Gene Names
pad1, POH1, Rpn11
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000115233 on the Human Protein Atlas

Wang B, Xu X, Yang Z, Zhang L, Liu Y, Ma A, Xu G, Tang M, Jing T, Wu L, Liu Y

POH1 contributes to hyperactivation of TGF-β signaling and facilitates hepatocellular carcinoma metastasis through deubiquitinating TGF-β receptors and caveolin-1

EBioMedicine , 2019 Feb 7; 41:320-332. Epub 2019 Feb 7

PubMed ID: 30745168 DOI: 10.1016/j.ebiom.2019.01.058

Wang B, Ma A, Zhang L, Jin WL, Qian Y, Xu G, Qiu B, Yang Z, Liu Y, Xia Q, Liu Y

POH1 deubiquitylates and stabilizes E2F1 to promote tumour formation

Nat Commun , 2015 Oct 29; 6:8704. Epub 2015 Oct 29

PubMed ID: 26510456 DOI: 10.1038/ncomms9704

Laetsch TW, Liu X, Vu A, Sliozberg M, Vido M, Elci OU, Goldsmith KC, Hogarty MD

Multiple components of the spliceosome regulate Mcl1 activity in neuroblastoma

Cell Death Dis , 2014 Feb 20; 5(2):e1072-. Epub 2014 Feb 20

PubMed ID: 24556687 DOI: 10.1038/cddis.2014.40

Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M

Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics

Mol Cell Proteomics , 2009 Jul; 8(7):1612-1622. Epub 2009 Apr 7

PubMed ID: 19351664 DOI: 10.1074/mcp.M800539-MCP200

Did we miss your publication?

Have you published using HPA002114? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch