Enhanced Validation

Anti-PRAME Antibody

preferentially expressed antigen in melanoma
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human PRAME
Alternative Gene Names
CT130, MAPE
Price
$450.00
Product Number
HPA045153
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
preferentially expressed antigen in melanoma
Target Gene
PRAME
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000028591 (55%)

Rat ENSRNOG00000037035 (55%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
preferentially expressed antigen in melanoma
Gene Name
PRAME
Alternative Gene Names
CT130, MAPE
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000185686 on the Human Protein Atlas

Taniguchi Y, Ishida M, Saito T, Ryota H, Utsumi T, Maru N, Matsui H, Hino H, Tsuta K, Murakawa T

Preferentially expressed antigen in melanoma as a novel diagnostic marker differentiating thymic squamous cell carcinoma from thymoma

Sci Rep , 2020 Jul 23; 10:12286. Epub 2020 Jul 23

PubMed ID: 32704057 DOI: 10.1038/s41598-020-69260-z

Chang AY, Dao T, Gejman RS, Jarvis CA, Scott A, Dubrovsky L, Mathias MD, Korontsvit T, Zakhaleva V, Curcio M, Hendrickson RC, Liu C, Scheinberg DA

A therapeutic T cell receptor mimic antibody targets tumor-associated PRAME peptide/HLA-I antigens

J Clin Invest , 2017 Jun 19; 127(7):2705-2718. Epub 2017 Jun 19

PubMed ID: 28628042 DOI: 10.1172/JCI92335

Oyama K, Kanki K, Shimizu H, Kono Y, Azumi J, Toriguchi K, Hatano E, Shiota G

Impact of Preferentially Expressed Antigen of Melanoma on the Prognosis of Hepatocellular Carcinoma

Gastrointest Tumors , 2016 Aug 3; 3(3-4):128-135. Epub 2016 Aug 3

PubMed ID: 28611979 DOI: 10.1159/000448137

Daniel Nettersheim, Isabell Arndt, Rakesh Sharma, Stefanie Riesenberg, Sina Jostes, Simon Schneider, Michael Hölzel, Glen Kristiansen, Hubert Schorle

The cancer/testis-antigen PRAME supports the pluripotency network and represses somatic and germ cell differentiation programs in seminomas

British Journal of Cancer , July 21, 2016

PubMed ID: None DOI: 10.1038/bjc.2016.187

Zhang W, Barger CJ, Eng KH, Klinkebiel D, Link PA, Omilian A, Bshara W, Odunsi K, Karpf AR

PRAME expression and promoter hypomethylation in epithelial ovarian cancer

Oncotarget , 2016 Jun 13; 7(29):45352-45369. Epub 2016 Jun 13

PubMed ID: 27322684 DOI: 10.18632/oncotarget.9977

Field MG, Decatur CL, Kurtenbach S, Gezgin G, van der Velden PA, Jager MJ, Kozak KN, Harbour JW

PRAME as an independent biomarker for metastasis in uveal melanoma

Clin Cancer Res , 2016 Mar 1; 22(5):1234-1242

PubMed ID: 26933176 DOI: 10.1158/1078-0432.CCR-15-2071

Did we miss your publication?

Have you published using HPA045153? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch