Enhanced Validation

Anti-POSTN Antibody

periostin, osteoblast specific factor
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human POSTN
Alternative Gene Names
OSF-2, periostin, PN
Price
$445.00
Product Number
HPA012306
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
periostin, osteoblast specific factor
Target Gene
POSTN
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000012660 (95%)

Mouse ENSMUSG00000027750 (95%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
periostin, osteoblast specific factor
Gene Name
POSTN
Alternative Gene Names
OSF-2, periostin, PN
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000133110 on the Human Protein Atlas

Paunas FT, Finne K, Leh S, Osman TA, Marti HP, Berven F, Vikse BE

Characterization of glomerular extracellular matrix in IgA nephropathy by proteomic analysis of laser-captured microdissected glomeruli

BMC Nephrol , 2019 Nov 14; 20:410. Epub 2019 Nov 14

PubMed ID: 31726998 DOI: 10.1186/s12882-019-1598-1

Zhang T, Han Z, Chandoo A, Huang X, Sun X, Ye L, Hu C, Xue X, Huang Y, Shen X, Chang W, Lin X

Low periostin expression predicts poor survival in intestinal type gastric cancer patients

Cancer Manag Res , 2018 Dec 18; 11:25-36. Epub 2018 Dec 18

PubMed ID: 30588108 DOI: 10.2147/CMAR.S175596

Oh HJ, Bae JM, Wen XY, Cho NY, Kim JH, Kang GH

Overexpression of POSTN in Tumor Stroma Is a Poor Prognostic Indicator of Colorectal Cancer

J Pathol Transl Med , 2017 Apr 12; 51(3):306-313. Epub 2017 Apr 12

PubMed ID: 28407462 DOI: 10.4132/jptm.2017.01.19

Attur M, Yang Q, Shimada K, Tachida Y, Nagase H, Mignatti P, Statman L, Palmer G, Kirsch T, Beier F, Abramson SB

Elevated expression of periostin in human osteoarthritic cartilage and its potential role in matrix degradation via matrix metalloproteinase-13

FASEB J , 2015 Jun 19; 29(10):4107-4121. Epub 2015 Jun 19

PubMed ID: 26092928 DOI: 10.1096/fj.15-272427

Alexandre Calon, Enza Lonardo, Antonio Berenguer-Llergo, Elisa Espinet, Xavier Hernando-Momblona, Mar Iglesias, Marta Sevillano, Sergio Palomo-Ponce, Daniele V F Tauriello, Daniel Byrom, Carme Cortina, Clara Morral, Carles Barceló, Sebastien Tosi, Antoni Riera, Camille Stephan-Otto Attolini, David Rossell, Elena Sancho, Eduard Batlle

Stromal gene expression defines poor-prognosis subtypes in colorectal cancer

Nature Genetics , February 23, 2015

PubMed ID: 0 DOI: 10.1038/ng.3225

Edlund K, Lindskog C, Saito A, Berglund A, Pontén F, Göransson-Kultima H, Isaksson A, Jirström K, Planck M, Johansson L, Lambe M, Holmberg L, Nyberg F, Ekman S, Bergqvist M, Landelius P, Lamberg K, Botling J, Ostman A, Micke P

CD99 is a novel prognostic stromal marker in non-small cell lung cancer.

Int J Cancer , 2012 Nov 15; 131(10):2264-73. Epub 2012 Apr 24

PubMed ID: 22392539 DOI: 10.1002/ijc.27518

Did we miss your publication?

Have you published using HPA012306? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch