Enhanced Validation

Anti-PODXL Antibody

podocalyxin-like
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human PODXL
Alternative Gene Names
Gp200, PC, PCLP
Price
$445.00
Product Number
HPA002110
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
podocalyxin-like
Target Gene
PODXL
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000025608 (43%)

Rat ENSRNOG00000012495 (41%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
podocalyxin-like
Gene Name
PODXL
Alternative Gene Names
Gp200, PC, PCLP
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000128567 on the Human Protein Atlas

Borg D, Larsson AH, Hedner C, Nodin B, Johnsson A, Jirström K

Podocalyxin-like protein as a predictive biomarker for benefit of neoadjuvant chemotherapy in resectable gastric and esophageal adenocarcinoma

J Transl Med , 2018 Oct 24; 16:290. Epub 2018 Oct 24

PubMed ID: 30355278 DOI: 10.1186/s12967-018-1668-3

Kusumoto H, Shintani Y, Kanzaki R, Kawamura T, Funaki S, Minami M, Nagatomo I, Morii E, Okumura M

Podocalyxin influences malignant potential by controlling epithelial–mesenchymal transition in lung adenocarcinoma

Cancer Sci , 2017 Apr 3; 108(3):528-535. Epub 2017 Apr 3

PubMed ID: 28004467 DOI: 10.1111/cas.13142

Borg D, Hedner C, Nodin B, Larsson A, Johnsson A, Eberhard J, Jirström K

Expression of podocalyxin-like protein is an independent prognostic biomarker in resected esophageal and gastric adenocarcinoma

BMC Clin Pathol , 2016 Jul 29; 16:13. Epub 2016 Jul 29

PubMed ID: 27478410 DOI: 10.1186/s12907-016-0034-8

Heby M, Elebro J, Nodin B, Jirström K, Eberhard J

Prognostic and predictive significance of podocalyxin-like protein expression in pancreatic and periampullary adenocarcinoma

BMC Clin Pathol , 2015; 15:10. Epub 2015 May 30

PubMed ID: 26028992 DOI: 10.1186/s12907-015-0009-1

Saukkonen K, Hagström J, Mustonen H, Juuti A, Nordling S, Fermér C, Nilsson O, Seppänen H, Haglund C

Podocalyxin Is a Marker of Poor Prognosis in Pancreatic Ductal Adenocarcinoma.

PLoS One , 2015; 10(6):e0129012

PubMed ID: 26053486 DOI: 10.1371/journal.pone.0129012

Forsström B, Axnäs BB, Stengele KP, Bühler J, Albert TJ, Richmond TA, Hu FJ, Nilsson P, Hudson EP, Rockberg J, Uhlen M

Proteome-wide Epitope Mapping of Antibodies Using Ultra-dense Peptide Arrays

Mol Cell Proteomics , 2014 Jun; 13(6):1585-1597. Epub 2014 Apr 4

PubMed ID: 24705123 DOI: 10.1074/mcp.M113.033308

Boman K, Larsson AH, Segersten U, Kuteeva E, Johannesson H, Nodin B, Eberhard J, Uhlén M, Malmström PU, Jirström K

Membranous expression of podocalyxin-like protein is an independent factor of poor prognosis in urothelial bladder cancer

Br J Cancer , 2013 Jun 11; 108(11):2321-2328. Epub 2013 May 7

PubMed ID: 23652315 DOI: 10.1038/bjc.2013.215

Dallas MR, Chen SH, Streppel MM, Sharma S, Maitra A, Konstantopoulos K

Sialofucosylated podocalyxin is a functional E- and L-selectin ligand expressed by metastatic pancreatic cancer cells

Am J Physiol Cell Physiol , 2012 Sep 15; 303(6):C616-C624. Epub 2012 Jul 18

PubMed ID: 22814396 DOI: 10.1152/ajpcell.00149.2012

Cheung HH, Davis AJ, Lee TL, Pang AL, Nagrani S, Rennert OM, Chan WY

Methylation of an intronic region regulates miR-199a in testicular tumor malignancy.

Oncogene , 2011 Aug 4; 30(31):3404-15. Epub 2011 Mar 7

PubMed ID: 21383689 DOI: 10.1038/onc.2011.60

Larsson A, Johansson ME, Wangefjord S, Gaber A, Nodin B, Kucharzewska P, Welinder C, Belting M, Eberhard J, Johnsson A, Uhlén M, Jirström K

Overexpression of podocalyxin-like protein is an independent factor of poor prognosis in colorectal cancer.

Br J Cancer , 2011 Aug 23; 105(5):666-72. Epub 2011 Aug 9

PubMed ID: 21829192 DOI: 10.1038/bjc.2011.295

Larsson AH, Lehn S, Wangefjord S, Karnevi E, Kuteeva E, Sundström M, Nodin B, Uhlén M, Eberhard J, Birgisson H, Jirström K

Significant association and synergistic adverse prognostic effect of podocalyxin-like protein and epidermal growth factor receptor expression in colorectal cancer

J Transl Med , 1/01/01; 14:128. Epub 2016 May 10

PubMed ID: 27160084 DOI: 10.1186/s12967-016-0882-0

Did we miss your publication?

Have you published using HPA002110? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch