Enhanced Validation

Anti-PNKD Antibody

paroxysmal nonkinesigenic dyskinesia
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human PNKD
Alternative Gene Names
BRP17, DKFZp564N1362, DYT8, FKSG19, FPD1, KIAA1184, KIPP1184, MGC31943, MR-1, PDC, PKND1, TAHCCP2
Price
$445.00
Product Number
HPA010134
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
paroxysmal nonkinesigenic dyskinesia
Target Gene
PNKD
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKNPMKA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000026179 (96%)

Rat ENSRNOG00000014806 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
paroxysmal nonkinesigenic dyskinesia
Gene Name
PNKD
Alternative Gene Names
BRP17, DKFZp564N1362, DYT8, FKSG19, FPD1, KIAA1184, KIPP1184, MGC31943, MR-1, PDC, PKND1, TAHCCP2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000127838 on the Human Protein Atlas

Signes A, Cerutti R, Dickson AS, Benincá C, Hinchy EC, Ghezzi D, Carrozzo R, Bertini E, Murphy MP, Nathan JA, Viscomi C, Fernandez‐Vizarra E, Zeviani M

APOPT1/COA8 assists COX assembly and is oppositely regulated by UPS and ROS

EMBO Mol Med , 2018 Dec 14; 11(1):e9582. Epub 2018 Dec 14

PubMed ID: 30552096 DOI: 10.15252/emmm.201809582

Sadegh MK, Ekman M, Krawczyk K, Svensson D, Göransson O, Dahan D, Nilsson BO, Albinsson S, Uvelius B, Swärd K

Detrusor Induction of miR-132/212 following Bladder Outlet Obstruction: Association with MeCP2 Repression and Cell Viability

PLoS One , 2015; 10(1):e0116784. Epub 2015 Jan 24

PubMed ID: 25617893 DOI: 10.1371/journal.pone.0116784

Did we miss your publication?

Have you published using HPA010134? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch