Enhanced Validation

Polyclonal Anti-PLP1 Antibody

proteolipid protein 1
References (4)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human PLP1
Alternative Gene Names
GPM6C, PLP, SPG2
Open Datasheet
Price
$505.00
Product Number
HPA004128
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA004128 antibody. Corresponding PLP1 RNA-seq data are presented for the same tissues.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
proteolipid protein 1
Target Gene
PLP1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000031425 (100%)

Rat ENSRNOG00000002419 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA004128 on the Human Protein Atlas
Protein Name
proteolipid protein 1
Gene Name
PLP1
Alternative Gene Names
GPM6C, PLP, SPG2
UniProt ID
P60201
Gene (Ensembl)
ENSG00000123560
Entrez Gene ID
Entrez gene: 5354
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000123560 on the Human Protein Atlas

Nishino S, Fujiki Y, Sato T, Kato Y, Shirai R, Oizumi H, Yamamoto M, Ohbuchi K, Miyamoto Y, Mizoguchi K, Yamauchi J

Hesperetin, a Citrus Flavonoid, Ameliorates Inflammatory Cytokine-Mediated Inhibition of Oligodendroglial Cell Morphological Differentiation

Neurol Int , 2022 May 31; 14(2):471-487. Epub 2022 May 31

PubMed ID: 35736620 DOI: 10.3390/neurolint14020039

Hattori K, Tago K, Memezawa S, Ochiai A, Sawaguchi S, Kato Y, Sato T, Tomizuka K, Ooizumi H, Ohbuchi K, Mizoguchi K, Miyamoto Y, Yamauchi J

The Infantile Leukoencephalopathy-Associated Mutation of C11ORF73/HIKESHI Proteins Generates De Novo Interactive Activity with Filamin A, Inhibiting Oligodendroglial Cell Morphological Differentiation

Medicines (Basel) , 2021 Feb 1; 8(2):9. Epub 2021 Feb 1

PubMed ID: 33535532 DOI: 10.3390/medicines8020009

Matsumoto N, Miyamoto Y, Hattori K, Ito A, Harada H, Oizumi H, Ohbuchi K, Mizoguchi K, Yamauchi J

PP1C and PP2A are p70S6K Phosphatases Whose Inhibition Ameliorates HLD12-Associated Inhibition of Oligodendroglial Cell Morphological Differentiation

Biomedicines , 2020 Apr 16; 8(4):89. Epub 2020 Apr 16

PubMed ID: 32316234 DOI: 10.3390/biomedicines8040089

Did we miss your publication?

Have you published using HPA004128? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-PLP1 (AMAb91639)
Corresponding Antigens
PrEST Antigen PLP1 (APrEST74534)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch