Anti-PLD3 Antibody

phospholipase D family, member 3
Recommended Applications
Product Description
Polyclonal Antibody against Human PLD3
Alternative Gene Names
HU-K4
Price
$437.00
Product Number
HPA012800
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
phospholipase D family, member 3
Target gene
PLD3
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSAN
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000003363 (90%)

Rat ENSRNOG00000018390 (90%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
phospholipase D family, member 3
Gene Name
PLD3
Alternative Gene Names
HU-K4
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000105223 on the Human Protein Atlas

Tan M, Li J, Ma F, Zhang X, Zhao Q, Cao X

PLD3 Rare Variants Identified in Late-Onset Alzheimer’s Disease Affect Amyloid-β Levels in Cellular Model

Front Neurosci , 2019 Feb 14; 13:116. Epub 2019 Feb 14

PubMed ID: 30837833 DOI: 10.3389/fnins.2019.00116

Mukadam AS, Breusegem SY, Seaman MN

Analysis of novel endosome-to-Golgi retrieval genes reveals a role for PLD3 in regulating endosomal protein sorting and amyloid precursor protein processing

Cell Mol Life Sci , 2018 Jan 24; 75(14):2613-2625. Epub 2018 Jan 24

PubMed ID: 29368044 DOI: 10.1007/s00018-018-2752-9

Satoh JI, Kino Y, Yamamoto Y, Kawana N, Ishida T, Saito Y, Arima K

PLD3 is accumulated on neuritic plaques in Alzheimer’s disease brains

Alzheimers Res Ther , 2014; 6(9):70. Epub 2014 Nov 2

PubMed ID: 25478031 DOI: 10.1186/s13195-014-0070-5

Did we miss your publication?

Have you published using HPA012800? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch